5J8J,5IKK


Conserved Protein Domain Family
Arb2

?
pfam09757: Arb2 
Click on image for an interactive view with Cn3D
Arb2 domain
A second fission yeast Argonaute complex (Argonaute siRNA chaperone, ARC) that contains two previously uncharacterized proteins, Arb1 and Arb2, both of which are required for histone H3 Lys9 (H3-K9) methylation, heterochromatin assembly and siRNA generation. This family includes a region found in Arb2 and the Hda1 protein.
Statistics
?
PSSM-Id: 401634
View PSSM: pfam09757
Aligned: 43 rows
Threshold Bit Score: 299.489
Threshold Setting Gi: 730173509
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5J8J_A        10 LQKAIRQQQQHYLSDEFNFVTLPLVSMDLP---DNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDN 86  Saccharomyces c...
EED24551     492 FHDVIRQYQAKKLYDNYKLTSLWIYRASISksfENQVLASSNYDKAVPLVVIFHDPPDMMGIHHPITNKLEPHNCWMADV 571 Talaromyces sti...
EED55241     206 LHDVIRAYQSKRLYENYKLTSLYIYRTAISrsfENQVLATPNYYQRNPLLVIFHDPPEIMGLPHPVTNKLEAHNCWLADS 285 Aspergillus fla...
XP_016596934 502 LHDVLRVYQSNQLYESCKLTPLHIYRTAISksfDKQVLASTNYHQRVPLIVIFHDPPEIVGQAHPVTNKLEAHNVWMADS 581 Penicillium exp...
EPS34986     423 LHDVLREYQAHQLYENFKLTPLYIYRNKISksfQNQVLASANYHERVPLIVIFHDPPELMGYPDPVTSKLEAHNCWMSDA 502 Penicillium oxa...
EME47335     494 MHNIVREWQAEIMFTEHRMFPLSIQRQELAreyENQVLATSNYLEPRPLLLILHDPPEVLASPDPRTGRVELHNTWLTDI 573 Dothistroma sep...
EON61769     505 MHDIIREWQSSVMWENYGMVPLLIHHTNLSksfENQVLATRNYADANPLLVIFHDPPDVQGVPDPRTNKLELHNTYLTDV 584 Coniosporium ap...
EKG19671     505 IHDIVRQADANDLWNQYRMTELFILRDKISrsfEKQVLATQNFSEERPLLVIFHEPPETTALTDARSKKISLHNIFVTDV 584 Macrophomina ph...
KEQ76823     395 LHDIVRDYQAAWLWENLGMSSLFIAHSKASrsfKNQVLATPNHAEARPLLVIFHDPPELTGDTDPRTRELQLHNTWLTDS 474 Aureobasidium n...
KEQ78941     465 IHDIVREYQAGWLWENLGMSDLFIAHSKTSrsfTNQVLATSNHSESRPLLVIFHDPPDLVGTPDPRTQRLELHNTWLTDS 544 Aureobasidium p...
5J8J_A        87 SLDFIKWGLDRKYGIIDVNIPLt-----------LFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSGI 155 Saccharomyces c...
EED24551     572 VKDYIAWAHRRNYAIIDVNIPKhvtad--ssdigKFEEDDVDRPAQTEELAGYLWDNYIEPND-ATHIFFIGVGDAFYGV 648 Talaromyces sti...
EED55241     286 LKDYIGWAVGKGYAVMDVNIPKhvtv----epsgKYEDEEENRPTATEELAAYLWDNYIEPNE-ATEIFFLGIGNAFYGV 360 Aspergillus fla...
XP_016596934 582 LTEYVEWIVGKGYAVIDVNIPKhvsre---tapgRYEADDEDRPSATEELAGYLWDNYIDANQ-ATEIFLLGVGNAFFGV 657 Penicillium exp...
EPS34986     503 QKDYIGWIISKGYAVIDVNIPKhvtqv---patgKYEEEDENRPTATEELANYLWDNYIDFFDK-REVFFLGVGSAFAGV 578 Penicillium oxa...
EME47335     574 VKTYVDWAVRQGFAVIDVNLPRhiaeydkdnrehKETDSIESRTREATQVLTYLWENHVELNE-ATHVFLMGTNIGHGAI 652 Dothistroma sep...
EON61769     585 TKTYVDWAVKQGFGVIDVNIPKhytqdd-dnadyAETESQESRKALTREVATFLWENYIEPEN-ATHIFLMGIGTAYFGV 662 Coniosporium ap...
EKG19671     585 TKTYVEWAVKHGFGVIDVNIPEhitdpn-dlpeyAEADSDEARGLLTRELITYLWENYISLGDN-THKFFIGVGAAYSGI 662 Macrophomina ph...
KEQ76823     475 VKQYLQWAVDQGFAVIDINIPKhltevd-dnheyAEEADAQQRIDETELLAKYLWENYIELSD-ASHMFLMGVGQAYSSL 552 Aureobasidium n...
KEQ78941     545 VKQYIRWAYDRGFAVIDVNVPKhltdle-ethehAEEIDGKKTIDETQLLAKYLWDNYIELSES-KHIFMLGIGKAYTSI 622 Aureobasidium p...
5J8J_A       156 VHLLGHR---DTRAVTKTVINFLGDk-QLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENe-sRKPRKKFGRVLRCDT 230 Saccharomyces c...
EED24551     649 ANLLINRd--SIYQRVNSVISFVAEn-PVRAVASPTQTWLSRWYKDNSLVFVAHTHGVWHNEn-rRKPSKRYGRLLRSPK 724 Talaromyces sti...
EED55241     361 ANLLINRd--TLYKRVNGVVSFVAEn-PVRAIASHTQVWLSRWYKDNSLVFVSHTHGVWNTDenrRKPSKRYGHLIQSSR 437 Aspergillus fla...
XP_016596934 658 SNLLINRe--NLYKRVNGVISFVSEn-PVRAVTSHTQTWLSKWYRENSLVFVSNSHGIWATPd--RRSSKRYGQLVHSPK 732 Penicillium exp...
EPS34986     579 VNLLINRe--NLYKRVSGIISFVAEn-PVRAVASSTQVWLSKWYRDNSLVFVSESHAVWKDQd--RKPSKRYGTLFKSSK 653 Penicillium oxa...
EME47335     653 LNFIKAHe-dQAQNLMTKVISFVQDv-SLISCKSPTNDLLPGWYYSTSMVFVANDHSYWATEy-aRKPKKRFGRVSRSEE 729 Dothistroma sep...
EON61769     663 LDLISSHertTESDKVDLVICFVADn-PLNTVKRPADDNITNWYYDHSLVFVASDHLAWDPAr-qRKIKKRYGNLVRSSR 740 Coniosporium ap...
EKG19671     663 LDLMGENd--DCTKETDHIFAFVGEn-SLQSIKKLTDDYIGHWYYDSSHVFVANNHAAWDPAr-qRKLRKKYGNVLRSQH 738 Macrophomina ph...
KEQ76823     553 IGFLKKNd--RCRERVDKIFGFISDscALPSYRATTDDFLDRWYKDKSKIFVAQNHYVWERHk-tKAPSRKWGSLQKSDG 629 Aureobasidium n...
KEQ78941     623 VNFLKENd--RCRERLTKVIGFISDecTLPSYKSTTDDFLDRWYRDASKIFVATGHYVWEKHk-fKPPGKKWGTLQRSDY 699 Aureobasidium p...
5J8J_A       231 DGLNNIIEERFEEATDFILDS 251 Saccharomyces cerevisiae S288C
EED24551     725 TGLNEMLLQHKTEVFTWIEQR 745 Talaromyces stipitatus ATCC 10500
EED55241     438 SGLSEMLMHHKEEVFQWIEDR 458 Aspergillus flavus NRRL3357
XP_016596934 733 SDLNEMLDEHKEEVYKWISER 753 Penicillium expansum
EPS34986     654 SSLGEMMTEHQQQVFEWLADR 674 Penicillium oxalicum 114-2
EME47335     730 SSISDMLLEHRDEIFRTLLSE 750 Dothistroma septosporum NZE10
EON61769     741 GRITDQLIEHREQVHEALLKC 761 Coniosporium apollinis CBS 100218
EKG19671     739 SDLSEMLEEHRATVTEVLLSK 759 Macrophomina phaseolina MS6
KEQ76823     630 NDMQEMLSHHVKEVTGILGVE 650 Aureobasidium namibiae CBS 147.97
KEQ78941     700 NDMQEMLSHHCKEVTGILTVL 720 Aureobasidium pullulans EXF-150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap