Conserved Protein Domain Family
DDRGK

?
pfam09756: DDRGK 
DDRGK domain
This is a family of proteins of approximately 300 residues, found in plants and vertebrates. They contain a highly conserved DDRGK motif.
Statistics
?
PSSM-Id: 370664
View PSSM: pfam09756
Aligned: 12 rows
Threshold Bit Score: 145.568
Threshold Setting Gi: 124444407
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0BRS7         84 VQNAEQQAKREARKQKKQQQQQYVRQQIEMLEKKNEKRSKEYEEK-----ERQREQQEQEEEEWRKKIEAEQKQKEQEEF 158  Paramecium te...
XP_018653061   98 KKVGSKKAAKLAEKERRKEEREAEERYREHQRKIEDMEIEKRKKA-----EEAEEKAAAAAAAAEAKRREEEAAREQAEY 172  Schistosoma m...
P34623        107 KKIGKRKAAKLQAKEEKRQMREYEVREREERKRREEEREKKRDEE-----RAKEEADEKAEEERLRKEREEKERKEHEEY 181  Caenorhabditi...
Q295B1        109 EKMGAKKRAKMEAKEQKRLHREQELIDREQRKVKEAKEEAERKQQ-----EDFQEEADRKRAEAERLVKEERERKEHEEY 183  Drosophila ps...
Q80WW9        116 GKIGAKKLRKLEEKQARKAQREAEEAEREERKRLESQREAEWKKE-----EERLRLKEEQKEEEERKAQEEQARREHEEY 190  house mouse
Q6P0E5        103 GKVGAKKQRKLEEKQARKAQREAEQEEREERKRLQELRDQERQKE-----EEKERQQEQKQEEELQRVKEEQERREEEEY 177  zebrafish
CAG06621       99 aKIGTKKQRKLEEKQARKAQREVEMEEREERKRMQELREQEKRQD-----EEKERLLEQKQEEDRRRAKEEQERQEEEEY 173  spotted green...
Q55CM7        132 KKIGKKKLEKLKLKDEKRKAREYQEYLREEKKKTDLEKEEALKEK-----RLEEKENEKLRKEEEERIRIEKERKEDEEY 206  Dictyostelium...
Q4UBS5         78 KVLTAKQRKRQEIKEERRRLKALEDEEREERRKLLAKK------------QEQIEAKRLEREALMEEQERKKREEEEKAY 145  Theileria ann...
XP_001609113   60 RSLTVKQRKKQELKEAKRQQRALIDEERKEKEKLKQQR------------DDLREKRREEKERQRQEEEEKRAAKAQEAY 127  Babesia bovis...
Q8IIG1       2329 KELNEVSKLKNNLKGKTYNSNIGEEMLEENKEKQHGNYVGEYFDRndmilKERIFEYAKHKTSIDMLKHPDDIKRNSKDL 2408 Plasmodium fa...
Q246A2        102 qtRTQRELAREAKKQQKRQQREAMQQYYEQREQRDNQKKSKYEER-----DRLRELEEQKKEEEQRKQEELQRIKEQEEF 176  Tetrahymena t...
A0BRS7        159 DKWSSMFQVEQSGTMKLSAEEEEQktkeFNERLANYIKLRKVVQLEEVSAELGISTTEVVDKIKQLEMLGSLNGLIDERG 238  Paramecium te...
XP_018653061  173 ERLKQEFSIEEEGLDAQQQDDKAKa--lINAQIIAAIEEAKIIPVEHLAINLNLKTEVCIENIKALMSSGRLTGVLDDRG 250  Schistosoma m...
P34623        182 LAMKASFAIEEEGTDAIEGEEAEN----LIRDFVDYVKTNKVVNIDELSSHFGLKSEDAVNRLQHFIEEGLVQGVMDDRG 257  Caenorhabditi...
Q295B1        184 LKMKAGFSVEEEGFEEGDADDQDN----LLADFIQYIKDNKVVLLEDLAVAFKLKTQQAIERIQDLQANGTLTGVIDDRG 259  Drosophila ps...
Q80WW9        191 LKLKEAFVVEEEGVSETMTEEQSHs---FLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRG 267  house mouse
Q6P0E5        178 QRLKESFIIEDQGEAEELTEHESQs---LLQEFIQYVQKSKVVLLEDLASQFGLRTQDAIARLQDLIADGSLTGVIDDRG 254  zebrafish
CAG06621      174 LRLKASFVVEEQGEEDQLTEDQSRn---LLKEFIEYIENNKVVLLEDLASHFGMRTQDAIDRLQNLLAEGSITGVIDDRG 250  spotted green...
Q55CM7        207 NLLKSQISLQESGITKNEDYDKS-----LLQLFIKYLKEHKICLLEDIAIEFNIKTNEVIDRIKTLDKQGLISGVIDDRG 281  Dictyostelium...
Q4UBS5        146 QELVSTFVVESEGTISETNQY-------TVDDFIDYIVSKKLSNVEELSARFSLKASEVIKRIQELEDQNKIFGLLDDQG 218  Theileria ann...
XP_001609113  128 EAIASEFVVEQEGTIQDHEVF-------DVEDFINFVIEKKMTTIVELAAKFDLDHKVVASRLNDLELQGRLFGLLDERG 200  Babesia bovis...
Q8IIG1       2409 KKWKSQVITKKYADDWLSSDV-------LLSCFLNFIKLKKYVNITELSVKFQTTTDDIREKLEELEEQDMINGVLDEKG 2481 Plasmodium fa...
Q246A2        177 ENWKKFMEVEESGQEKMSAEEEERyyreLNEKITNYIKLRKVVVLEEMTGEFKITTQEVIDRIKSLEINKQINGIIDERG 256  Tetrahymena t...
A0BRS7        239 KYIHIRQNEIESLINYINARGRM-TRSELLNESNRIIK 275  Paramecium tetraurelia
XP_018653061  251 KVIHITNDEYEAVAQYIEKCGRV-TLSELVENGHKLIR 287  Schistosoma mansoni
P34623        258 KFIYISDEEFAAVAKFINQRGRV-SIHEIAEQSNRLIR 294  Caenorhabditis elegans
Q295B1        260 KFIYVSEEELAAVAKFIKQRGRV-SIVELAESSNNLIN 296  Drosophila pseudoobscura pseudoobscura
Q80WW9        268 KFIYITPEELAAVANFIRQRGRV-SITELAQASNSLIS 304  house mouse
Q6P0E5        255 KFIFITPEELNAVAQFIKQRGRV-SISELAQASNTLIN 291  zebrafish
CAG06621      251 KFISITPAELDSVARFIRQRGRV-SISELAQASNSLIN 287  spotted green pufferfish
Q55CM7        282 KFIYITKEEMEAVAKFVNKKGRV-NIEQIALESNRLID 318  Dictyostelium discoideum
Q4UBS5        219 RYVYITDDEAESVISYLKSKGKLhKQRDLLSFFNSTIS 256  Theileria annulata
XP_001609113  201 RYLYISDSELDALDHYINKEGRIdKYTGLTSFCNATIS 238  Babesia bovis T2Bo
Q8IIG1       2482 NYIYLSQEEINKLCFEIQSKGKVnTHDDFVKICNKVIS 2519 Plasmodium falciparum 3D7
Q246A2        257 KYIYITPTELESVKNYIISKGRV-SRSDLIAECNRLIK 293  Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap