Conserved Protein Domain Family
DUF2046

?
pfam09755: DUF2046 
Uncharacterized conserved protein H4 (DUF2046)
This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain.
Statistics
?
PSSM-Id: 401633
View PSSM: pfam09755
Aligned: 9 rows
Threshold Bit Score: 361.068
Threshold Setting Gi: 215495136
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009016245  12 T-------SSVESVPTDLRglPSGVLLQQLNKRVESLQQENRVLRMELDTFRYKCKSLEEENRELKKARVTIQLMAEQQE 84  Helobdella robusta
EKC40647      12 T-------SSIDGGPTLKP--PSPAAVEQLQKRIESLQQENRVLKMELETYKLKCKTLQEEKKELQKASVNIQARAEQEE 82  Pacific oyster
EEN52083      23 S-------ESTDGGGSKAT---SPT--EELHNRISSLQQENRVLKIELETFRMRCKALQEENKALRKASVSIQARAEQEE 90  Florida lancelet
XP_001625318  17 Sd------MSADEG--------SSTATHRDRGLIHLLKQENRVLKMELDTCRLRCKSLQEENRALRQASVSIQAKAEQEE 82  starlet sea ane...
A0AUQ3        11 TdgatphcSSSSSSSILI----SSFRLEELSNRLASLQQENKVLKIELETFKLKCKALQEENRDLRKASVTIQARAEQEE 86  zebrafish
XP_002128917   8 TdgslvytASTSSASQVAA---VAVKRNELAIRVASLQQENRVLKMELETYKLRCNALQEENKALRQASVNIQARAEQEE 84  vase tunicate
EEC04777      18 S-------SSVDGAMVA----PSPLTREQFQKRVESLQQENRVLKMELETYRLRVKTLQEENRELRQVSVNIQAKAEQEE 86  black-legged tick
XP_014255792  10 S-------SSIDGGPIMMP--PSPITREQLQKRIESLQQQNRVLKVELDTYKLRVKALQEENRSLRQASVFIQAKAEQEE 80  bed bug
EDW33085       1 mespceseSSLDGG-TMLP--PSPVSREQLQKRIESLTQQNKVLKAELDTFKTKCKVVQEENRCLKQASVIIQAKAEQEE 77  Drosophila pers...
XP_009016245  85 EYISNTLLKKIQALKNEKEQLARNYEQEEEFLTNDLSRKLFQLRQEKCELEVTLEKEQEYQVNK-------------LMR 151 Helobdella robusta
EKC40647      83 EFISNTLLKKIQALKKEKEALAMNYEQEEEFLTNDLSRKLHQLRQEKVELEQTLEKEQEYQVNK-------------LMR 149 Pacific oyster
EEN52083      91 EFISNTLLKKIQSLKKEKEKLAMNYEQEEEFLTNDLSRKLMKLREEKVQLEQTLEQEQEFQVNK-------------LMR 157 Florida lancelet
XP_001625318  83 EFISNTLLKKIQSLKKEKETLAMNYEQEEEFLTNDLSRKLTQLRQEKIQLEQTLEQEQEYQVNK-------------LMR 149 starlet sea ane...
A0AUQ3        87 EFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNK-------------LMK 153 zebrafish
XP_002128917  85 EFISNTLMKKIQELKKEKETLVNKYETEEEFLTNELQRQLSQLRQEKVELEQTLEKEQEKQVNT-------------LMR 151 vase tunicate
EEC04777      87 EFISNTLLKKIQALKKEKETLALNYEQEEECLTNDLSRKLNQVGTE-------LGRRHHVNIQNhfyfffiiiiiiiILR 159 black-legged tick
XP_014255792  81 EFISNTLLKKIQALKKEKETLAHHYEQEEECLTNDLSRKLTQLRQEKCKLEQTLEQEQECLVNK-------------LMR 147 bed bug
EDW33085      78 EYISNTLLKKIQALKKEKETLAHHYEREEECLTNDLSRKLDQLRQEKCKLEQTLEQEQECLVNK-------------LMR 144 Drosophila pers...
XP_009016245 152 RIEKLQAEVVNKQANLEQLKKDKVELENQLEQEQEALVNRLWKRMDKLEAEKRMLQQKLDQPVSAPPSPRDSQamvvDGD 231 Helobdella robusta
EKC40647     150 KIEKLERETLTKQSTLEQLRREKVELENALEQEQESLVNRLWKRMDKLETEKRLLQEKLDQPVTGPPSPRDIS----NGD 225 Pacific oyster
EEN52083     158 KIEKLENEIHQKQNNLEQLRREKVELENTLEQEQEALVNRLWKRMDRLEAEKRLLQERLDQPVSAPPSPRELT----EGD 233 Florida lancelet
XP_001625318 150 RIDRLEADVLAKQTSLEQLRKEKVDLENTLEQEQELLVNRLWKRMDRLEAEKRMLQEKLEEPISEPPSPRQFTe---AED 226 starlet sea ane...
A0AUQ3       154 KIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDTIs--mEID 231 zebrafish
XP_002128917 152 KIEKLKRETHDKHYKLEELRREKIELENTLEKEQEGLVNRLWKKMDKLETEKRLLQEKLNQPVSAPPSPRQSVs--lEGG 229 vase tunicate
EEC04777     160 KEENLKLPV-----TLSLFGKVGVELESTLEQEQEALVNRLWKRMDKLEAEKRLLQERLEQPPSAPPSPRDP-----SRD 229 black-legged tick
XP_014255792 148 KIEKLEAETLAKQSNLEQLRREKVELENTLEQEQEALVNRLWKRMDKLEAEKRMLQIKLDQPVSDPASPRDMS----NGD 223 bed bug
EDW33085     145 KIEKLQAETDNKQTNLEQLRREMVELENTLEQEQEALVNKLWKRMDKLETEKRSLQIKLDQPVSDPTTPRDITinanGGD 224 Drosophila pers...
XP_009016245 232 AANNLVQNIQALKAEVLRLQNQLKTVQVEHKEKIVQYAEEERHIREENLRLQRKLQMEIERREQLCRHLSESESSLEMDD 311 Helobdella robusta
EKC40647     226 TAQNITDHIAKLRKEVVSLKSMLRAAQIEHEEKMAQYAQEEKHIREENLRLQRKLQLEMERRENLCRHLSESESSLEMDD 305 Pacific oyster
EEN52083     234 TAQNLTMHVQYLRNEVSKLRRQLELAQQEHAEKMAHYVAEEKQIKEENVRLQRKLLREMERREALSRQLSESESSLEMDE 313 Florida lancelet
XP_001625318 227 TVGGIASHITSLREEIRRLRQQLAKSEADYCEKMEAYAKEERQTKEENIRLQRKLLREMERREALSRQLSESESSLEMDD 306 starlet sea ane...
A0AUQ3       232 SPENMMRHIRFLKSEVERLKKNLRTSELQHTEKRAQYIEEERHMREENIRLQRKLQREVERREALCRQLSESESSLEMDD 311 zebrafish
XP_002128917 230 SSDQLTAHVRYLKKEVEWLRRQLKGMQNDRHSKINLFLSEEKSLREENARLHHQLLLETERREALSRQLSESESSLEMDE 309 vase tunicate
EEC04777     230 TPAALGAHVARLRGELARLRAQLHDTQQEHHEKVAQFAQEERQIREENVRLQRKLQLEMDRREALCRHLSESESSLEMDE 309 black-legged tick
XP_014255792 224 TASNLSAHIQTLRGEVARLRMQLAHAQQEHTEKMERYVKEERHVREENLRLQRKLQLEVERREALCRHLSESESSLEMEE 303 bed bug
EDW33085     225 TATHLSSHIKALRSEVLRLRDNFAAAQKETTIKMQQFAQEEKSIREENARLQRKLKQEVERREALCRHLSESESSLEMDE 304 Drosophila pers...
XP_009016245 312 ERFV 315 Helobdella robusta
EKC40647     306 ERHF 309 Pacific oyster
EEN52083     314 ERAF 317 Florida lancelet
XP_001625318 307 ERYv 310 starlet sea anemone
A0AUQ3       312 ERYF 315 zebrafish
XP_002128917 310 ESrh 313 vase tunicate
EEC04777     310 ERWv 313 black-legged tick
XP_014255792 304 ERHY 307 bed bug
EDW33085     305 ERFY 308 Drosophila persimilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap