Conserved Protein Domain Family
Membralin

?
pfam09746: Membralin 
tumor-associated protein
Membralin is evolutionarily highly conserved; though it seems to represent a unique protein family. The protein appears to contain several transmembrane regions. In humans it is expressed in certain cancers, particularly ovarian cancers. Membralin-like gene homologs have been identified in plants including grape, cotton and tomato.
Statistics
?
PSSM-Id: 401625
View PSSM: pfam09746
Aligned: 17 rows
Threshold Bit Score: 383.7
Threshold Setting Gi: 198434863
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003098362  54 NSLNAARDRLFHAMLVRIALKYSGRVSLRWRKAIEGSILFVALLLFASLIFIHFNFTRSPATCLDSMQADWIRKGIVRIE 133  Caenorhabditis...
Q7K4L9        44 NNMMNMRDRLFHAIYFRAAATYAELVPRKVQLTIEFLLLAKALLFFFTLIYVHNSFIKNPCTCLQDVKN-WPREGVIRVE 122  fruit fly
3_pfamImport   1 ------EEGLLFYMLYWATLEYATIIPRFLRRVIEFVFLLQAVFSIFLLIYVHINFSQEPAGCFDLVKDIWPRDGVLRVE 74  
XP_016657149  35 sqelglLESLFCDIFFNANRGYARIFSRSLRRVIEFIFLLQAVLSFFVLVYVHVRFSRMPANCLDNVKNVWPRDGILRVE 114  pea aphid
XP_002600544  12 NHLGNVRDRLFHALFFKVAITYARAFPKPVRRVFEFLVLLKALVVLFILVYIHIAFSRTPITCLDHVQKEWPRDGILRVE 91   Florida lancelet
Q0VA72        26 NPLINVRDRLFHALFFKMAVTYARLFPPSFRRIFEFFVLLKALLVLFILAYIHIAFSRSPINCLEHVREKWPRDGILRVE 105  tropical clawe...
1_pfamImport   1 DPLLTARDRLFHVLFFNMALIYSRLFPPTFRRVFEFFVLLKALFVLFILAYVHTAFSPEPINCSQYRWSDNPGTGLLQVE 80  
XP_009024019  21 HPFFNVRERLFHALFHRIAVAYCRAVPSSFRIALEIFALLKALVLFFVLCYIHVVLARGPKHCLQHIKQNWPRDGVLRVE 100  Helobdella rob...
EFX71033      20 NQLATVRDRMFHAIFHRMAIAYARTFPKPIRRLLEWLFLLKALAAFLMLLYIHIIFSRSPITCLDHIKADWPREGIVRID 99   common water flea
XP_002923582  18 NPLINVRDR--HALFFKMAVTYSRLFPPAFRRLFEFFVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDKWPREGILRVE 95   giant panda
XP_003098362 134 VVRN--------------LEVLEEKENFISSYisdnshrtchFNPIDVFRFGPS-VIPYSMK-ERQAAKarqmkiaspfR 197  Caenorhabditis...
Q7K4L9       123 IIPHlae--------kraIWQGIKRDQEIVRS----------LKDSYYYGIGPQ-TR--QNHeTLKRYEsilgklglpvR 181  fruit fly
3_pfamImport  75 IINSfkrsvd--iseknsLLFSRFTKTYSPEVtiiianskvlQDNFYVHLLYFS-CFFFFFYaNEKEKLfssttktnsiR 151 
XP_016657149 115 IIRNfqhshaeptgtineLLEKSYEREYKIKRigmreknatlFNRFTKTNSPEK-KGEVDIVqSTDE------------- 180  pea aphid
XP_002600544  92 IQRNstr--------pplFLYDYESESGIPGLe----------------------------------------------- 116  Florida lancelet
Q0VA72       106 IQLNssr--------apiFLQFYDSDT-----------------------FPGL-VKEPSGEdEEEEEE----------M 143  tropical clawe...
1_pfamImport  81 IEQNagpag-----vpshLVIEAKEE--------------------------------VKVElSEENSGkleldvqlkkL 123 
XP_009024019 101 VLRNapp--------gysLAHSYRKEDDDNGG----------VNDSNVTSHDDQ-RAAVAATaAEDENRsv--------- 152  Helobdella rob...
EFX71033     100 ITRSgngpd----iqgysLHHSYAKEQRIHQR----------EQFEYQAMFGFW-SGPYSSSaDSEETEssalkettelL 164  common water flea
XP_002923582  96 VQHNssr--------apvFLQFCD----------------------------GGxVEPGSPElGEEEAE----------L 129  giant panda
XP_003098362 198 PMTYYSS--VLSFlrpnlf-----fdeeeEEtvkhydsVeeleyqdpleaeahiafyetmKDRPEPReyeylYRVEYAML 270  Caenorhabditis...
Q7K4L9       182 PTFAYSN--ESLYyyfdainildtydhpnAIqlkneedD-------------------------EEQ-----YIVEYSLE 229  fruit fly
3_pfamImport 152 GVLGIDSilQSTRtnlsl--------------------------------------iddhKVKLNEN-----YIVEYSLY 188 
XP_016657149 181 ---LIEN--KSGEtnlf----------------------------------------nyfEVIFESD-----YIVEYSLE 210  pea aphid
XP_002600544 117 --vPFPN--ATIQglnenfenlsisavefLRgddnpvpQkglqkvretv---sefdmfkeaVWPSDE-----YIVEYSLE 184  Florida lancelet
Q0VA72       144 SVEMYHN--SSIKfeldi------epkvfLKpslesvtQasenqsqt-----lsfsdaasKVWPQEE-----YIVEYSLE 205  tropical clawe...
1_pfamImport 124 SFPKAKP--TGMQplvktvp---------------------------------llevmarEAWPQGK-----YRVQYSLR 163 
XP_009024019 153 -------gwSRMLsnllalhdlsissltsLIfnnvgnnDggdddng-------kvasdvgTIWPEDK-----YIVEYSLE 213  Helobdella rob...
EFX71033     165 SDEIYFN--DTLTnnitnldderidsl-------------------lptevseldkiiraTVWPPEE-----YIVEFSLE 218  common water flea
XP_002923582 130 AVDMFGN--TSVKfeldi------epkvlKPpggteapNdsqelp---------fpetptKAWPQDE-----YVVEYSLE 187  giant panda
XP_003098362 271 YGVLRLPPD-FREEHGIPTTWIRID-SKSRCFGDQMSRLMMRLFVGYEDTIIAALRGQAYNlslvhpeTHSMGYLHNLQT 348  Caenorhabditis...
Q7K4L9       230 YGHLRLSSS-TRKRLRIPVLTVQLDpNTDKCFGDSLTRYLLKRLLGYDDLLMASVRTIAEQ-------EENKGYLRNVIT 301  fruit fly
3_pfamImport 189 EEYLILSPS-DRSQYGIPVMLVALDlTNNKCYGDSVSQFYLKYFLDYDHFMLWFVNSISEN----------KGFIRNVIS 257 
XP_016657149 211 YGLLNLSPS-ARNRSSIPVMLVTLDpTLH--YNDSVSQFFLENFLGYDDLLFSCVKSLAEN-------EQNKGFFRNVIS 280  pea aphid
XP_002600544 185 YGFLRLSPQ-TRQRLNIPIMVVTLDpTKDECFGDSFSRFLLEEFLGYDDILMSSIKGLAEH-------EDNKGYLRNVVS 256  Florida lancelet
Q0VA72       206 YGFLRLSQS-TRQRLNIPVMVVTLDpTRDLCFGDRFSRFLLDEFLGYDDILMSSVKALAEN-------EENKGFLRNVVS 277  tropical clawe...
1_pfamImport 164 YGLLLPSSQkTPQGRSLPAMVVKLNpKRHLCFAEQVRSLVLGKFLNYVNVHMSHMKTLGEN-------EESKSFLSSVFS 236 
XP_009024019 214 YGFLRLTPN-TRQQLNISVKLVVLDpMKDECFGDQLSRFLLDEFLGYDDVLMSSVKQLAED-------ETNKGYLRNVVN 285  Helobdella rob...
EFX71033     219 YGFLRLSPT-TRRKLNITILLVTLDpVNNTCFGDSFGRFLLDEFLGYNDFIMGAVKALAEA-------EDSQGYLRNVVT 290  common water flea
XP_002923582 188 YGFLRLSQA-TRQRLSIPVMVVTLDpSRDQCFGDRFSRLLLAEFLGYDDILMSSVKGLAEN-------EENKGFLRNVVS 259  giant panda
XP_003098362 349 HDHYHFVANS-LGKWSYITAAVLMIIFTFAISMLLRFSHHQI------FVFIIDLLHM-FELQQPLNPPVAPLITVVL-- 418  Caenorhabditis...
Q7K4L9       302 GEHYRFVSMWwAAWSSYPAAFCVMLLFTFSVSMLLRYSHHQI------FVFIVDLLQM-LEYNVSARFPIAPLLTVIL-- 372  fruit fly
3_pfamImport 258 GEHYNLGNIS-MDRMKYISSFLIM-AFDVYSCQQHRYKMRSTmelptpFLLSVQFCML-CTECSGQRLGLQPFIMSLLpg 334 
XP_016657149 281 EEYNRFDRMS-TSRMSYIASFFMMVVFTLLISMVIRYLQQQM------FVFFL-LVDLpLHFHRSVSFPVLPLLIAFL-- 350  pea aphid
XP_002600544 257 GEHYRFVSMW-MARTSYIAAAFVMFMFTISVSMLLRYSHHQI------FVFIVDLLQM-LEMNVTIAFPAAPLLTVIL-- 326  Florida lancelet
Q0VA72       278 GEHYRFVSMW-MARTSYLAAFVIMVIFTLSVSMLLRYSHHQI------FVFIVDLLQM-LEMNMSIAFPAAPLLTVIL-- 347  tropical clawe...
1_pfamImport 237 EEFYPFVSIW-LARTCYLTAFVIMLIFTLSVSVLLRYSHYQI------FIFIVDLLQM-LEMNMTIAFPAAPLLTVIL-- 306 
XP_009024019 286 GEHYRFVSIW-MAKSSYLAAAFIMVVFTLAVSMLLRYSHHQI------FVFIVDLLQM-LEMNRSLAFPAAPLLTVIL-- 355  Helobdella rob...
EFX71033     291 GEHYRFVNMW-MARTSYIASAFAMVIFTLSISMLLRYSRNQI------FIFIVDLLQM-LEFNINVTFPVASFFTVIL-- 360  common water flea
XP_002923582 260 GEHYRFVSMW-MARTSYLAAFVIMVIFTLSVSMLLRYSHHQI------FVFIG-------------NLPA---------- 309  giant panda
XP_003098362 419 ---ALV--GMEAIMAEVFNDTSIAFYVILIVWVADQYDAICCHSPTSKK 462  Caenorhabditis remanei
Q7K4L9       373 ---ALV--GMEAIMSEFFNDTTTAFYIILIVWIADQYDAICCHTSITKR 416  fruit fly
3_pfamImport 335 iceTLLafGVTVYMMSRFFNGPIMCYIQLIVILCDQYYNICSCCPITKR 383 
XP_016657149 351 ---ALV--GIKVIMSELFNDRTTAFFVILIVYLADQYDTKCSRCPITKK 394  pea aphid
XP_002600544 327 ---ALV--GMEAIMSEFFNDTTTAFYIILMVWVADQYDAICCHTNISKR 370  Florida lancelet
Q0VA72       348 ---ALV--GMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTNTSKR 391  tropical clawed frog
1_pfamImport 307 ---ALV--SMEAVMSEFFNDTTTAFYIILIVWLADQYDAICCHTNTSKR 350 
XP_009024019 356 ---ALV--GMEAIMSEFFSDTTTAFYIILIVWIADQYDAICCHTAVTKK 399  Helobdella robusta
EFX71033     361 ---ALV--GMEAIMAEFFNDSSTAFYVIIFVWVADQYDAVCCHTSVTKR 404  common water flea
XP_002923582 310 --------GMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTNTSKR 350  giant panda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap