Conserved Protein Domain Family
DUF2043

?
pfam09740: DUF2043 
Uncharacterized conserved protein (DUF2043)
This is a 100 residue conserved region of a family of proteins found from fungi to humans. This region contains three conserved Cysteines and a motif of {CP}{y/l}{HG}.
Statistics
?
PSSM-Id: 401619
View PSSM: pfam09740
Aligned: 43 rows
Threshold Bit Score: 119.627
Threshold Setting Gi: 74859106
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
F1MX48       473 RAPVVPFGVDLCYWGQ--EElmagkILKCD----SE----HRFWKPCEVdAEVESASVSEALRSRRITFA-GQFEPVqHR 541 cattle
XP_006339719 408 EAPIMKWGSFLDDWGSrsRD-----VLANQ----RGldldGHW-GRVDH-DAVIPAEKIAELKVHATVYR-EDPVEI-QP 474 potato
XP_018686546 318 EAPVLSWGPFLDNWGSk-RD-----VLANQ----RGleldGHW-GRVDY-DAVIPAERIAELSVHRTVYK-EEAVEI-QP 383 wild Malaysian ...
XP_002264071 405 EAPLMNWGSFLDNWGSk-QD-----VLANQ----RGleleGHW-GRVDY-DAVIPAEKIAELNIQTTVYK-EERVDI-QP 470 wine grape
XP_002878414 404 EAPVMNWGSQLSNWDSt-TE-----VRANY----RGleleSHW-GRVDQ-DAVIPAEKIAELNLQATVYR-EERTET-PP 469 Arabidopsis lyr...
XP_002302633 406 EAPVIEWGSFLDTWGSn-RD-----VLANH----RGleleSHW-GRVDH-DAVIPAKKIAELNLQATLYK-EDRVET-QP 471 black cottonwood
ERN14096     400 KAPVMTWGSFLDSWGMv-RD-----VPANQ----RGmeleCHW-GRVDY-DAVIPAEKIAELNVQMTYYN-EQHGEI-RP 465 Amborella trich...
EFJ08751     401 EAPVLPWGSFLDAWGSd-AA-----VPANN----RGlvldNHW-GRVDP-DALISTEKMAEMQVRASYYQ-PLKSEL-RP 466 Selaginella moe...
EDQ72722     424 KAPILPYGSFLDSWGAt-SD-----VPANQ----RGlemdNHW-GRFDS-EAMIPGDKIAEMNVRSSFYK-PPEREI-VP 489 Physcomitrella ...
EGF83386     423 lAPEVPYDNDLYYWDK--QD-----VSFSSissnAGldfhHRFLGDGPT-DRVLSKDALSSLRKRQMYLIaEAPKNI-PA 493 Batrachochytriu...
F1MX48       542 CRAPRPDGQLCARQDRLKCPFHGKIIPRDDAGRPL 576 cattle
XP_006339719 475 CRAPLRNGELCQRRDLKICPFHGPIIPRDDEGKPI 509 potato
XP_018686546 384 CLAPLRKGGLCQRKDLRVCPFHGPIIPRDALGNPI 418 wild Malaysian banana
XP_002264071 471 CRAPLSKGGLCQRQDLRVCPFHGPIIPRDDEGKPI 505 wine grape
XP_002878414 470 CRAPLKKGGLCQRRDLRVCPFHGPIVPRDDEGKPI 504 Arabidopsis lyrata subsp. lyrata
XP_002302633 472 CRAPLRKGGLCQRRDLRVCPFHGPIIPRDDEGNPI 506 black cottonwood
ERN14096     466 CFAPLKKGGLCQRRDLRVCPFHGPIVPRDVEGNPI 500 Amborella trichopoda
EFJ08751     467 CSAPLRNGGLCQRRDLRKCPLHGTIIPRDDRGNPL 501 Selaginella moellendorffii
EDQ72722     490 CRAPLKKGGLCPRRDLFRCPLHGPIIPRDDNGNPI 524 Physcomitrella patens
EGF83386     494 CRAPLRTGALCPRRDLVRCPVHGKIIPRDDTGTPL 528 Batrachochytrium dendrobatidis JAM81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap