Conserved Protein Domain Family
Tau95

?
pfam09734: Tau95 
RNA polymerase III transcription factor (TF)IIIC subunit
TFIIIC1 is a multisubunit DNA binding factor that serves as a dynamic platform for assembly of pre-initiation complexes on class III genes. This entry represents the tau 95 subunit which holds a key position in TFIIIC, exerting both upstream and downstream influence on the TFIIIC-DNA complex by rendering the complex more stable. Once bound to tDNA-intragenic promoter elements, TFIIIC directs the assembly of TFIIIB on the DNA, which in turn recruits the RNA polymerase III (pol III) and activates multiple rounds of transcription.
Statistics
?
PSSM-Id: 401613
View PSSM: pfam09734
Aligned: 63 rows
Threshold Bit Score: 101.972
Threshold Setting Gi: 402549477
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCF52767           308 MVPPAFFSRMDVPFNYGFQQTPYSELRTvaapphlrkppgatsfahalkrddlaPGQm-QRFVNRVRLSNIAPQPFRpgr 386 Ustilago ...
JCVI:AT3G49410.1   171 MLLPQFFAPKDIPDNVA------------------------------------------LKPPATSGPKKKDDAATQnfy 208 thale cress
KRH28878           172 IIVPPIFAPKDVPENLV------------------------------------------LRPATMSSSKKKPEEVVQphf 209 soybean
EDR04994           199 LFPPPLFSRQTIPQGYNFKGNPASMVSIsvd---------------------eqTGEekKRLINKMRWKGYGPAAIMfsd 257 Laccaria ...
XP_003331701       198 LFPPPLFSRYLVPQLYHYRQNIPTVVTqt------------------------sDGS--QRLINRTRYVPMGPQTITydq 251 Puccinia ...
CCA66550           200 SFPSPLFTRYDMPMNYNFKPNPSSIQQTvvd---------------------keTGEtsTRLVNSSRLRMQTPVSIKwge 258 Serendipi...
XP_001567004       326 VFPPQHFLSSRAPFE--VRYEPGRDLNTavaaasaatapggdrlavdanddssaAQYd-LATLPTISVSAEESSVLP--- 399 Leishmani...
WGS:AEVR:RTG_00425 208 FIPPPAFSRHRLPQNFDMRPAFGTTIQtt------------------------eSGV--TRLVHAARSKTRTIRSIMsfe 261 Rhodotoru...
KDE09825           184 FLPPPIFARHTVPLKYEYKPAARTVPTTsi----------------------rpSGQevLRLASSTRYKTKPHTTIPhss 241 Microbotr...
XP_001961905       158 LSLPELFTHVDVVFSGTYRLDSVEdg-------------------------------qqDVLGVMSKSTYDNQDVVSfnm 206 Drosophil...
CCF52767           387 d-------------tkiP-TKAMQDVIRIEH-------RCDPAVLA-RLKELLNERPIWSRVALKNQLSDAEVrelhgYN 444 Ustilago ...
JCVI:AT3G49410.1   209 eidvgpvfaidfsvkeiPkKLKWEDFVSRSSn-----hWQWQVAVS----ALFEERPIWTRDSVVQRLLDKGLkc-thHM 278 thale cress
KRH28878           210 emdmepvlaidfdikeiPkKVNWEEYIPQGSd-----qWELQMVVS----RMFDERPIWSKNSLTELLLDKGLsf-shSM 279 soybean
EDR04994           258 --------------phvP-LKPPDAVEKGRD-------QISEVILA-KLQAVFVDRPIWTRMSLFNQFAPLETre--ilN 312 Laccaria ...
XP_003331701       252 --------------pdvP-QSALARDLEQKK-------PENQALFQ-KLASLFEQRPIWSRMAFQHHLTPVDLry--irQ 306 Puccinia ...
CCA66550           259 ---------------ptP-TTCGPERESLRP-------WANSDLLQ-KLNELLEKRPVWTRQGLLNQMTLLEArr--mhN 312 Serendipi...
XP_001567004       400 -----------------TrQAAHNNFLRSMGssldgglDTDPPEVQ-MMVRLLAERPSWVVQDLQDAMLQSGLcp-raYR 460 Leishmani...
WGS:AEVR:RTG_00425 262 --------------eqvP-TGPEEVLLKELG-------REEPNAIEaRLMQLLEERPVWTRPAMMNHLTPAEVkm-vhAN 318 Rhodotoru...
KDE09825           242 --------------ptvP-SEPTPELLQVVG-------RRTHDALEiKLLAYLERRPVWTRQSLLNQLSEQELrt--iqN 297 Microbotr...
XP_001961905       207 v-------------dvfP-TQPDAQSLKRLKi-----kYVSDEQFA-SIKKLFDDCPIWTRIALQYE--SGLTn----DK 260 Drosophil...
CCF52767           445 EKVYYALVGYSMVGGPWRDAIVRFGYDVRKNADSRIYQRIFL 486 Ustilago hordei
JCVI:AT3G49410.1   279 LNRFLLRAAYYFSSGPFLRFWIKRGYDPRNDPESRVYQRMEF 320 thale cress
KRH28878           280 LRRLLSRISYYFSSGPFLRFWIKKGYDPRKDPNSRIYQRIDY 321 soybean
EDR04994           313 SKLLLPLVCYVFQDGPWRDTLVRFGYDPRSDPSARFYQRLYF 354 Laccaria bicolor S238N-H82
XP_003331701       307 NKVILAHYCYLFSDGPFRELLIRFGYDPRLIPEARFFQRMSL 348 Puccinia graminis f. sp. tritici CRL 75-36-700-3
CCA66550           313 NKAPWALATYVFHEGPWRDSVIKLGYDPRQDPESVKYQIVSI 354 Serendipita indica DSM 11827
XP_001567004       461 NKQVMQCFTYLIRNGPFNRLRLRLGYDPYASASSAVYERIAV 502 Leishmania braziliensis MHOM/BR/75/M2904
WGS:AEVR:RTG_00425 319 KSQCWARVGYTFSDGPFRDLIVRFGYDPRQHPEARFLQHITL 360 Rhodotorula toruloides ATCC 204091
KDE09825           298 RKTAIPMVSYSFQDGPFKELVIRFSYDPRQHVEARLYQHIVL 339 Microbotryum lychnidis-dioicae p1A1 Lamole
XP_001961905       261 LRCIIPLLAYYFSNGPWRSLYVRFGYDPRRDFHSRFYQTFDF 302 Drosophila ananassae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap