Conserved Protein Domain Family
BicD

?
pfam09730: BicD 
Microtubule-associated protein Bicaudal-D
BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER). For full functioning they bind with GSK-3beta pfam05350 to maintain the anchoring of microtubules to the centromere. It appears that amino-acid residues 437-617 of BicD and the kinase activity of GSK-3 are necessary for the formation of a complex between BicD and GSK-3beta in intact cells.
Statistics
?
PSSM-Id: 370639
View PSSM: pfam09730
Aligned: 7 rows
Threshold Bit Score: 807.154
Threshold Setting Gi: 121956588
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006507087  74 GQSFSIHRKVAEDGETREETLLQESASKEAYYLNKILEMQNELKQSRAVVTNVQAENERLSAVVQELKE----------- 142 house mouse
Q921C5        83 GQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLTSVAQELKE----------- 151 house mouse
Q17BK6        71 QKFQKTQQVTTKSGIEQEDALLNESAAMETSLNLQILELENETKQLRHELERVTNERDRMLQENSEIGR----------- 139 yellow fever mo...
AAI34922      81 ADSVSSHKRAAADGESREERLLQESANKEAEMDIRMDELQAELKQARVMLNNTSAENERLVSLSTQMKK----------- 149 zebrafish
CAG03949      57 aDSVSSQKRAAADGECREECLLQETASKEAAMATRIEEVQAELKQTRLALSNTHAEIDRLAVFSTQLKK----------- 125 spotted green p...
CAG11345       4 GQAYTNHRKVAADGESREESLIQESACKEAYYEQRVLELQNDLRQARNLVANAQSENDRQNALSQEIKDtgscandtnag 83  spotted green p...
CAG06883      83 GQAYSTHRKVAADGESREESLILESASKEALYQQKLLELQNELRQAKASFSSVQAENERLASIVLDMREvpiyf------ 156 spotted green p...
XP_006507087 143 ------NNEMVELQRIRMKDEIREYKFREARLLQDYTELEEENITLQKLVSTLKQNQVEYEGLKHEIKRFEEETVLLNSQ 216 house mouse
Q921C5       152 ------INQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQ 225 house mouse
Q17BK6       140 ------DKSGAEAERARLKAELKDMKYRETRMLSDYSELEEENISLQKQVSSLRSSQVEFEGAKHEIRRLAEEIELLNSQ 213 yellow fever mo...
AAI34922     150 ------ECECLEVEKTRMREEMKEYKTREAQQLQDNSELEEENISLQKQVSVLKENQVEFESVKLELTHKDEELELMRAQ 223 zebrafish
CAG03949     126 ------ECECLEAEKGHMRDEMKEYKVRELRLLQDNAELEEENTSLQKQESVLKENQVEFEGIKLELTQKNEEQEELRGQ 199 spotted green p...
CAG11345      84 perrqdHSQMVELQRNQLRDDIKEYKLLEARLLQDYTELEEENITLQKQVSVLKQSQVEFEGLKHEIRRLEEDTQFLNSQ 163 spotted green p...
CAG06883     157 --fktqNSELAELQRGQLRDDIREYKVREARLLQDCSELEEENISLQKQVSVLRQNQVEFEGLKHEIRRFEEDSQCLQSQ 234 spotted green p...
XP_006507087 217 LEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYINLSD----SHISISVDGLKFAED---GSEPNND-DKM-NG 287 house mouse
Q921C5       226 LEDAIRLKEISERQLEEALETLKTEREQKNNLRKELSHYMSINDsfytSHLQVSLDGLKFSDDt-vTAEPNNDaEALvNG 304 house mouse
Q17BK6       214 VEELASLKKIAEKQMEDALTALQIEREQKYALKKELDTHINRESlynlSNMAIT----AIRKGideSTLNSSDcEDE-QP 288 yellow fever mo...
AAI34922     224 LEEAGRLREIAEHQLDEALEALKEEREQKNSLRREVAA-LTLNPfdsiSHLEIQL---NDSRDgekDREEGEEdEEM-DS 298 zebrafish
CAG03949     200 LDEAARLREIAEKQLDEALEALKEEREQKNSLRRELSA-LTLNPfdsvGNLELHLDQLDDSREegrGGEREGEgEDQ-DS 277 spotted green p...
CAG11345     164 LEDAIRLKEIAERQLGEALETIKTERELKASLRKELSHYMNIGDalynSPLSISLDGLKFSEEa--ATEPNND-EAL-LG 239 spotted green p...
CAG06883     235 LEEAVRLREIAERQLTEALETIKTEREQKATLRKELSHYMTIGGsvygGSFSISIDNLKLHEDpsaNTEPDND-DLI-RG 312 spotted green p...
XP_006507087 288 HIHGp-------------LGKLNG-DYRTPTTRKGESL--HP----VSDLFSELNISEIQKLKQQLIQVEREKAILLANL 347 house mouse
Q921C5       305 FEHSg-------------LVKSSL-DNKTSTPRKDGLA--PPspslVSDLLSELHISEIQKLKQQLVQMEREKVGLLATL 368 house mouse
Q17BK6       289 ALKDst-----------lKR-----LETLEAE-TADLK--SPdg-tKVDLFSEIHLNELKKLERQLESIDNEKLSLTANL 348 yellow fever mo...
AAI34922     299 GYNNsk-----------gME-----RNRCSTPRNSEVFlrPQapglVSDLLSELHLSDSQKLKQQLIQVEREKATLSSTV 362 zebrafish
CAG03949     278 GFNNgpgsapssashlggSKNNGL-LHRFSTPRSSDVFlrAPasglVSDLLSELQFSDSQKLKQQLLQTEREKTSLVDKV 356 spotted green p...
CAG11345     240 YENGft-----------kLANAINyDNCVSTP-KKELF--PPapslVDDLLSELNISEIQKLKQQLMQMEREKVNLLTTL 305 spotted green p...
CAG06883     313 FENGl-------------LKVSEG-----GEDKKGEAF--KPapslVDDLLSELNICEIQKLKQQLMQVEREKVVLISSL 372 spotted green p...
XP_006507087 348 QESQTQLEHTKGALTEQHERVHRLTEHVNAMRGLQNSKEIKAELDCEKGRNSAEE---AHDYEVDINGLEILECKYRVAV 424 house mouse
Q921C5       369 QDTQKQLEQARGTLSEQHEKVNRLTENLSALRRLQAGKERQTSLDNEKDRDSHED---GDYYEVDINGPEILACKYHVAV 445 house mouse
Q17BK6       349 REAQQNLDKSQNEMQNFMAKIMLLAAHVDALAN---LKKQIASEDKFANVSNNKD--------------KVMNDKLNEAI 411 yellow fever mo...
AAI34922     363 HELQQQLVQSKDAFSEQQEKMDQLTQHLENLQNMITKRSAEDGNRMSSSPTSQDPengINYYEVDTKSTEVLECRMQAAN 442 zebrafish
CAG03949     357 EELQMQLVMSKQALSQQEDKVGSLTQQLEAVKG-----GQQDADDSGDQKSENAT----LEYEVDTKSKEVLEARMRSAS 427 spotted green p...
CAG11345     306 QDSQKQLEQANGALSEHQDKVNRLTENLNAIRKLQASKERQSALDNEKERDSHED---GDYYEVDINGPEILECKYKVAV 382 spotted green p...
CAG06883     373 QESQKQLEQAYGTVSEQKETVNRLTENLSAMRKLQASKERQSALDSEKDRDSHDD---GDYYELDINGPEILQCKYTVAM 449 spotted green p...
XP_006507087 425 TEVIDL----KAEIKALKEKYNKSVE--NYTEEKTKYESKIQMYDEQVTNLEKTSKESGEKMAHMEKELQKMTGIANENH 498 house mouse
Q921C5       446 AEAGEL----REQLKALRSTHEAREA--QHAEEKGRYEAEGQALTEKISLLEKASHQDRELLAHLEKELKKVSDVAGETQ 519 house mouse
Q17BK6       412 LQYSNWftlsSKEIDTLKADLVELQKglNCSDAMAVLRNEITNLKNKLLSSEQ-------KSLDLHSDVHVLTTLSQTAG 484 yellow fever mo...
AAI34922     443 EELARL----HVKLKDAEKRYKTLEE--RCKLEKQRWRGEAQDLADQIRQCITASRQDQERIGQLEREIGATRKVATDSE 516 zebrafish
CAG03949     428 EELLKL----RDELTQAGARYNTLEQ--RYKQEKDRWRAEAQDLADKIRQCIKSSKQDQERIGELEKEIGATRKVASDSE 501 spotted green p...
CAG11345     383 SEAGEL----KEELKTLKAEYQACQS--RYEDDRARLENDVTTLGEKLASLEKTSHVDREEKNKLETELRKLRDVAGESQ 456 spotted green p...
CAG06883     450 SEAGEL----RQELKTLRAKYEKCRN--QYEEEQTRLERDVQELRSKLQTLERISHLDKAEMARLEKELRLVSEAAGESL 523 spotted green p...
XP_006507087 499 NTLNTAQDELVTFSEELAQLYHHVCLCNNETPNRVMLDYYRQSRVTRSgSlkGPDDPRGLLSPRLSRRGVsspvesrTSS 578 house mouse
Q921C5       520 GSLNVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREGQGKAG-R--TSPEGRGRRSPVLLPKGL-------LAT 589 house mouse
Q17BK6       485 QSLNSTRSNLVSLSDDLAQLYHLVCTVNGETPNRVLLDHKND-------------------------------------- 526 yellow fever mo...
AAI34922     517 GHLSAAQEELLAFSEDLANLYHHVCVSNNLTPSRVTLDYYREGAQAVRtQ--NHQLPHHYRGSLRRQRRS---------G 585 zebrafish
CAG03949     502 GHLSVAQEELLAFSEELSILYHHICVCNNLTPKRVTLDYYRDGARASArK--SHVYPQHLRKPRADDVFAskasvlqFMG 579 spotted green p...
CAG11345     457 GSLSVAQDELVTFSEELATLYNHVCMCNNETPNRVMLDFYKEGKGGR-----SSPEGRGRRSPILLTKGL--------FP 523 spotted green p...
CAG06883     524 GSLNVAQDELISFSEELANLYNHVCMCNNETPNRVMLDYYKQGKAIIK----KGQEGKEPPSSILLTNGM-------IET 592 spotted green p...
XP_006507087 579 EPVSKENTetSKEPSPTK-TPTiSPVitappsspvldtSDIR--KEPMNIYNLNAIIRDQIKHLQKAVDRSLQLSRQRAA 655 house mouse
Q921C5       590 EVGRADGGtgDNSPSPSS-SLP-SPL------------SDPR--REPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIA 653 house mouse
Q17BK6       527 ----------DLSFDNDSlSAIqSQLksdiltskphvfEDLQalSDAVEIKKYVDTISDQIKYLKSAVEHTIELNKDKVS 596 yellow fever mo...
AAI34922     586 EVLDPNSTgsGDAPSNCG-SCPgSPT------------LDFR---DPTNVRNLVAVIRCQIKHLQVAVD----LCRQRSL 645 zebrafish
CAG03949     580 EMDTAGTG--SESP-----NCPgSPI------------LDFR---DPSNVRNLVAVIRCQIKHLRVAVD----LCRQRGA 633 spotted green p...
CAG11345     524 EPGKTDLS--DRAPSPVS-SLP-SPV------------SDHR--REPMNIYNLVAIIRDQIKHLQLAVDRTTELSRQRVA 585 spotted green p...
CAG06883     593 EV--------KNSPSGNS-SVTlAPT------------SDHR--PEPMNIYNLVAIIRDQIRHLQQAVDRTTELSRQRLA 649 spotted green p...
XP_006507087 656 ----ARELAPMIDKDKEALMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKNKYENEKAMVTETMTKLRNEL 731 house mouse
Q921C5       654 ----SQELGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNEL 729 house mouse
Q17BK6       597 dvaaGDKDAK---EEIADLHEQIIKLKSLLSTKREQIATLRTVLKSNKNTAEVALTNLKSKYENEKLVVSDTMSKLRNEL 673 yellow fever mo...
AAI34922     646 lsspAAGGSTESDRDTEALIEEVLKLKSLLSTKREQIATLRTVLKANKQTAELALTNLKTKYETEKSMVTETMMKLRNEL 725 zebrafish
CAG03949     634 vpysGLSSSEESERDAESLLEEVLKLKSLLSTKREQIATLRTVLKANKQTAELALSNLKTKYETEKSIVSETMMKLRNEL 713 spotted green p...
CAG11345     586 ----SLELGTVADKDKEACMEEILKLKSLLSTKREQIATLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNEL 661 spotted green p...
CAG06883     650 ----NLELSSVADKDKEACMEEILKLKSLLSTKREQIATLRAVLKANKQTAEVALANLKSKYDSEKAMVKETMMKLRNEL 725 spotted green p...
XP_006507087 732 KALKEDAATFSSLRAMFATRCDEYVTQLDEMQRQLAAAEDEKKTLNTLLRMAIQQKLALTQRLEDLEF 799 house mouse
Q921C5       730 KALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLEL 797 house mouse
Q17BK6       674 RILKEDAATFSSLRAMFAARCEEYVTQVDELTHQLSAAEEEKKTLNQLLRLAVQQKLGLTQKLEDLEM 741 yellow fever mosquito
AAI34922     726 KALKEDAATFSSLRVMFASRCDQYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEA 793 zebrafish
CAG03949     714 KALKEDAATFSSLRVMFASRCDQYVTQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEa 781 spotted green pufferfish
CAG11345     662 KGLKEDAATFSSLRAMFATRCDEYVMQLEEMQRQLTAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEF 729 spotted green pufferfish
CAG06883     726 KALKEDAATFSSLRAMFATRCDEYVTQLDDMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLEDLEF 793 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap