Conserved Protein Domain Family
CortBP2

?
pfam09727: CortBP2 
Cortactin-binding protein-2
This entry is the first approximately 250 residues of cortactin-binding protein 2. In addition to being a positional candidate for autism this protein is expressed at highest levels in the brain in humans. The human protein has six associated ankyrin repeat domains pfam00023 towards the C-terminus which act as protein-protein interaction domains.
Statistics
?
PSSM-Id: 401608
View PSSM: pfam09727
Aligned: 34 rows
Threshold Bit Score: 127.739
Threshold Setting Gi: 768910234
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q179Y2         2 DFSKTDLLKLLSYLEGELQARDVVIAVLKTEKVKQllNTARYSKPtnlNDPHAALYRDNlassgniasrQSSIQAAYSEH 81  yellow fever mo...
XP_002119326  40 KLSKGELLRLLSILEGELEARDIYITTLQ-AQLNVghANARYFQHk-iRDPFLALIRDN----------EAMNGNVTTDT 107 vase tunicate
ELW65268       5 KLSKPELLTLFSILEGELEARDLVIEALKAQH-RDtfIEERYG-KyniSDPLMALQRDF----------ETLKEKNDGEk 72  Chinese tree shrew
XP_003454327  20 SLSKPELLMLFSILEGELEARDLVIEALKAQR-KElfIQERYG-RynlSDPFQALQRDS----------EAVGGQDKEAG 87  Nile tilapia
XP_007256204  10 TLSKAELLMLLSILEGELEAQDLVIHTLRAQH-RDafVQERYG-QydlSDPFLALQRDS----------EVLQGRERAQP 77  Mexican tetra
XP_003448340  10 ALSRAELLTLLSILEGELEAQDVVIHTLRAQH-KDafVQERYG-QydlSDPFLALQRDN----------EAMECQNTAA- 76  Nile tilapia
XP_014328870  10 ALSRAELLTLLSILEGELEAQDVVIHTLRAQH-RDefVQDRYG-EydlSDPFLALQRDE----------EAAERQTTIR- 76  southern platyfish
XP_006628428  10 NLSKPELLMLFSVLEGELEARDLVIEALRAQH-RDafVQERYG-KynlSDPFLALQRDN----------EVGRGLAQPEr 77  spotted gar
XP_027144331  10 ALSRAELLTLLSILEGELEAQDVVIHALRAQH-RDafVQERYG-QydlSDPFLALQRDN----------ESEERQNTLT- 76  large yellow cr...
XP_010772440   3 NLSKPELLTLLSIMEGELEARDLVIEALRAQR-KEvfLQERYG-HyslTDPFLALQRDF----------ESGVPGGDAE- 69  black rockcod
Q179Y2        82 EMrllndqrlgvkEQMDSLAALVMQQRQTQAKMVEVLKDAEERYKKVVQELEEERRKHEHTTAQGDDITYGLEIERSRLK 161 yellow fever mo...
XP_002119326 108 NFtripmlntktmQPLPLLEKLIQQFKNQQNKLQQHVALGEMYYQLVNEELLRTKRLHV----QANDTE-NLRKEQIKLR 182 vase tunicate
ELW65268      73 qp--------vctNPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQRHAQDTAEGDDVTYMLEKERERLT 144 Chinese tree shrew
XP_003454327  88 CSss-------tsNPLVVLKLVVSHCRRMQEKMLAQLAAAESRHRRVIADLEEEKRKHAEDTAEGDDVTYILEKERERLQ 160 Nile tilapia
XP_007256204  78 QDhshslrtqvspNPLAVLKLVMTHCKRMQEKMMAQLATAERRHRRVIADLEEEKRRHAQDTAEGDDVTYMLEKERERLL 157 Mexican tetra
XP_003448340  77 EPhthlqgravgpNPLAVLKLVMAHCKRMQERMMGQLAAAENRHRRMIADLEEEKRRHVQESAHHADFTFMLQTERDKLL 156 Nile tilapia
XP_014328870  77 QPqthplgravgpNPLAVLKLVMTHCKRMQERMMGQLAAAESRHRRMITALEEEKQRFVQESARRADYVFVLETERDKLL 156 southern platyfish
XP_006628428  78 gp--------lcsSPLTILKLVMSHCKRMQERMLAQLAAAESRHRKVIADLEEEKRRHAQDTAEGDDVTYMLEKERERLL 149 spotted gar
XP_027144331  77 QPhahlqgravgpNPLAVLKLVMAHCKRMQERMMGQLAAAESRHRRMIADLEEEKRRHAQDSAHSDDFTFMLQTERDKLL 156 large yellow cr...
XP_010772440  70 -Rrpl------gsSPISVLEAVMAHCRKMQERMSAQLAAAESRQKR---------------------------------- 108 black rockcod
Q179Y2       162 QELEHEKEQRKVLELELQKIQEQFEEEKNRQKQIVLLLLAERKK 205 yellow fever mosquito
XP_002119326 183 TLAFLEQKKVKHVANEYKKLLQIISSERKKYRMILSLLLEEKac 226 vase tunicate
ELW65268     145 QQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSMLVLECKK 188 Chinese tree shrew
XP_003454327 161 QQLDFERSQVRRLEKEQRRISDQLEEERAQHKQLSCALAKECKw 204 Nile tilapia
XP_007256204 158 QQLEFEKSRADRLEQDQQAASGQAQEDLAQQQQISSALAKECQR 201 Mexican tetra
XP_003448340 157 QQLEVERTTVQRLEKDKAQVVSKVEESLSQQQQLSSTLTLElqk 200 Nile tilapia
XP_014328870 157 QQLEVELATVQRLEKEQAQVVSKVEESLSQEQQLSSSLTlelqk 200 southern platyfish
XP_006628428 150 QQLDFEKAQVKRLEKEQKKLSGQAEEDRAQHKQLSSALAKECKR 193 spotted gar
XP_027144331 157 QQLEVEHATVQRLEKEQAQAVSKVEESLSQQQQLTSTLstelqk 200 large yellow croaker
XP_010772440 109 --LEMEKLQLQSLEQDHRKLTAQLKDEREKNKHIVMMLVRECKQ 150 black rockcod
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap