Conserved Protein Domain Family
Macoilin

?
pfam09726: Macoilin 
Macoilin family
The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.
Statistics
?
PSSM-Id: 401607
View PSSM: pfam09726
Aligned: 9 rows
Threshold Bit Score: 737.038
Threshold Setting Gi: 158293256
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2TLY1         2 KRRNAD-CSKLRRPLKRNRIT-EGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  zebrafish
XP_004082444   2 KRRNAD-CSKLRRPLKRNRIT-EGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  Japanese medaka
Q2TLY2         2 KRRNAD-CSKLRRPLKRNRIT-EGIHSSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  zebrafish
AAX11930       2 KRRNIEaGKPPRRPVKRAGKFaEGVCGSSFVYIKFILIWFFILMADFILEFRFEYMWPFWLLIQSVHDTFKYQGLAYSVF 81  Pacific transpa...
XP_015792346   2 RRRNADfCGKFRRPVKKSKLTsSGFYGSTFMYLKFLMVWSFVLFADFILEFRFEYLWPFWLLIRSVYDSFKYQGLAFSVF 81  two-spotted spi...
XP_558145      2 KRRNAD-CGKIRRPIKKNKIA-EQIGSNTLLYIKFLLLWASVITADFLLEFRFEFLWPFWLLLRSIYDSYKYKGLAFSVL 79  Anopheles gambi...
NP_001071887   2 KRRNTEaGKPPRRPVKRAGKFaEGVCGSSFVYIKFVTIWLFILLADFILEFRFEYMWPFWLLLQSVYDTFKYQGLAYSVF 81  vase tunicate
AAX11923       2 KRRNAD-CSKLRRPLKRNRIT-EGIYSSTFLYLKFLVVWVLVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  spotted green p...
XP_028936675   1 mkrrnadctKLRRPLKRNRIA-DGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  platypus
Q2TLY1        80 FVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKH--FHVDLCRPFAAH 157 zebrafish
XP_004082444  80 FVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAAH 157 Japanese medaka
Q2TLY2        80 FVCVAFTSDIICLLFIPKQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKH--FHVDLCRPFAAH 157 zebrafish
AAX11930      82 FVCIAITSDTVCLLFIPIQWLFFMASTYVWIHYVWHTDKGICIPTVSLWLFFMYIEATMRLRDLKNspFHIDLCRPFAAH 161 Pacific transpa...
XP_015792346  82 FVFIALTSDMICFLLIPVHWLFFVASTYVWVQYVWHTEKGICLPTLSLWLLFVYIEASFRLKELKNlpFHLDLCRPFAAH 161 two-spotted spi...
XP_558145     80 FVCIAVTSDLVCLFFIPVQWLFFAASTYVWVQYVWHTDKGICLPTIILWILFVYLEAAIRWKDSRNi-pHLNLCRPFAAH 158 Anopheles gambi...
NP_001071887  82 FVCIAITSDTICLLFIPIQWLFFMASTYVWIHYVWHTDKGICLPTVSLWLLFMYIEATMRLRDLKSspFHIDLCRPFAAH 161 vase tunicate
AAX11923      80 FVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAAH 157 spotted green p...
XP_028936675  80 FVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAAH 157 platypus
Q2TLY1       158 CIGY-PVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----QLIQRQEREAEEaaaAAAAAAsks-- 229 zebrafish
XP_004082444 158 CIGY-PVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----QMLQRQEREAEE---AAKGAS----- 223 Japanese medaka
Q2TLY2       158 CIGY-PVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----QMLQRQERETEEa--TSKGMS----- 224 zebrafish
AAX11930     162 CIGH-PVVTLGIGFKSYVSYRFKLRMQREVQKENVFFYELLRQALPKEQpnhtlSVTDKEKSETST---TSNGVL----- 232 Pacific transpa...
XP_015792346 162 CIGY-SVVTLGFGFKSHVSYKMRLRKQSEVAKENEFYFELLQKALPQET--------------------CATNLTdntsv 220 two-spotted spi...
XP_558145    159 CIGY-PVVTLGFGFKSYVGFRIRQRKQREVAKDNDFYMQLLQEALPKEEsralePLADGATGAGSEqltSTKELV----- 232 Anopheles gambi...
NP_001071887 162 CIGHpS-CDYGIGFKSYVSYRFKLRMQREVQKENTFYYELLRQALPKEQlnhtlSVTDKDKSEVSTpsnTSNGVL----- 235 vase tunicate
AAX11923     158 CIGY-PVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----QMLQRPEKETEE---VTKGIS----- 223 spotted green p...
XP_028936675 158 CIGY-PVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----QMLQRQEREAEE---AAKGLS----- 223 platypus
Q2TLY1       230 -ihDVD-SPAVAQNGSAGGKKp-----SSNTLPELEYREK---ERGK-NESKKQHNhnqnhhsstsssilPSVDNKAQEM 298 zebrafish
XP_004082444 224 ---EVE-TLPVTQNGAPPNKK------TSVPLPELEYREKgkdGRGG-GEAKKQHNsnn--------ilqPSLDSKIHEM 284 Japanese medaka
Q2TLY2       225 ---EAD-SVLVAQNGTAINKK------LPISLPELEYKEK---GKDS-AKDKKQQQhsigi----nnnilQTVDAKLQDI 286 zebrafish
AAX11930     233 -------PNHLNKKPHDRSKIpai-qdSTLQIAEINSSNHkssGAASgTPT-------------------------VTRK 279 Pacific transpa...
XP_015792346 221 isnCVPlPLALNHNHHSLNNKkaisgsSNEKTPTVSHNSSnisKLNNeYDSKKSYAng----------------idKQEL 284 two-spotted spi...
XP_558145    233 -------PVATSGNNHSLNS-------------------SsnsATSNrSDTGQHHHhnh--------hnhNHHHHNHQQQ 278 Anopheles gambi...
NP_001071887 236 -------PHV--KKSHDRSKSspishdNTLQIAEVTPSPTkttVSSSgSSSTPS----------------------LSRK 284 vase tunicate
AAX11923     224 ---EVE-PSVTSQNGAPPGKKs-----STLQLPELEYREK---AKDStGKEGKKvgin--------nnsiIHLDSKLQEA 283 spotted green p...
XP_028936675 224 ---DVDpSLILHHNGGIPSGKk-----LSPTLPELEYRDK---GRER-DKEAKKHNlgin------nnilQPVDSKIQEI 285 platypus
Q2TLY1       299 EYMENHVNsKRLSSSdlLGSTENLLKDEHSSSSSSSTSSNSN-----------------KNYKNASGGGGgGGSSSPRGH 361 zebrafish
XP_004082444 285 EYMENHMN-KRLTTE--LDSTESLLLKEDNNSSCSSSSSSSS-----------------KNYKNASSNAA-ALNSSPRGH 343 Japanese medaka
Q2TLY2       287 EYMENHLNaKRLNNEl-GGSAENLFLKEEVGAGGGSAPS--------------------KHYK----------NSSPRSH 335 zebrafish
AAX11930     280 SGHTNKSEpTPV-ITtsPTPETDLKRRSSARDKKTTDLSHS------------------PTQKTTKTn---SGNSSPKSL 337 Pacific transpa...
XP_015792346 285 QFMENPINkKPLSEYenDSNISDCNHEESFKNLTSSLSPN-------------------KSTEKLTNSMAsISLSSSNKL 345 two-spotted spi...
XP_558145    279 QHHASHSKsAQSYKSssSGSSSTTHVNGHVSSGSSPSSSSTNgsgqslaarkdydkettSNSSSAAAGSIgSSSSSSAKH 358 Anopheles gambi...
NP_001071887 285 S--ANKSVpEHIPIWtpPVQEIEVIFRKSNKSKKSSNESASS-----------------PTQQQQKSKSSnSGNNSPKSL 345 vase tunicate
AAX11923     284 EYIENYAGaKRLNND---------LAGENTDSNTHSTSKEEMag-------------tgKNFKYNSGGGAnISNSSPRNH 341 spotted green p...
XP_028936675 286 EYMENHINsKRLNNDl-VGSTENLLKEDSCSASS-------------------------KNYKNASG----AVNSSPRGH 335 platypus
Q2TLY1       362 GTANGSVPSSSgpsssassSSKGDRKQ-----------------------------KYGGGKNSA--SHRDPVEN----- 405 zebrafish
XP_004082444 344 STTNGSVAFSAsss--ttnTAKNDKKH-----------------------------KLPVGKGTAggSHKDPADN----- 387 Japanese medaka
Q2TLY2       336 NSTNGSVPSSS--------SNRSDKKQ-----------------------------KC-TGKNLA--PHRDLMEN----- 370 zebrafish
AAX11930     338 KHNSSSRSSST--------HSNDSEKP-----------------------------KQP--------------------- 359 Pacific transpa...
XP_015792346 346 NHSSNHVTSSN--------SNAN---------------------------------SLPFGNVQSlnISNKKTKN----- 379 two-spotted spi...
XP_558145    359 SNRSKSPTESSthsvavgsSKSNSNKQnghissqyhqpelvqqvactevatagsesKGGGGRSGRknRLKKAAEQqaqls 438 Anopheles gambi...
NP_001071887 346 KQNSSSRSSSV--------HSNDSEKQ-----------------------------KAP--------------------- 367 vase tunicate
AAX11923     342 SSSNGSVLSGS--------TSKNEKKQ-----------------------------KG-AGK-----AQKDPVEN----- 373 spotted green p...
XP_028936675 336 NAANGSIPSSA---------GKNEKKQ-----------------------------KC-AGKTPA--AHKDLMEN----- 369 platypus
Q2TLY1       406 -----------------------------------------------CIPNNQL-------------------------- 412 zebrafish
XP_004082444 388 -----------------------------------------------WIPNNQL-------------------------- 394 Japanese medaka
Q2TLY2       371 -----------------------------------------------CIPNNQL-------------------------- 377 zebrafish
AAX11930     360 -----------------------------------------------SLPNGHAvmkepimlpltnghavqekgnetkie 392 Pacific transpa...
XP_015792346 380 -----------------------------------------------NLANNLT-------------------------- 386 two-spotted spi...
XP_558145    439 aiaklcatlalassvttlttaagatlssggggdnattitsasytgagSVPSASVkdnhqhnseqvkesgdgrssssssga 518 Anopheles gambi...
NP_001071887 368 -----------------------------------------------ILPNGHLgvkeviplpltngh-vipektenkie 399 vase tunicate
AAX11923     374 -----------------------------------------------CIPNNQL-------------------------- 380 spotted green p...
XP_028936675 370 -----------------------------------------------CIPNNQL-------------------------- 376 platypus
Q2TLY1       413 --SKPEA-------------------------------------------LV-RLEQDVKKLKADLQASRQTEQDLRSQL 446 zebrafish
XP_004082444 395 --SKPEA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQDLRSQI 428 Japanese medaka
Q2TLY2       378 --SKPDA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQDLRSQI 411 zebrafish
AAX11930     393 liCTPSA-------------------------------------------IE-RLETTIAKLQAELAQARKNDSELNNRI 428 Pacific transpa...
XP_015792346 387 --SQKDE-------------------------------------------LViRLEADIKRLKAYLQASRQTELELKSQI 421 two-spotted spi...
XP_558145    519 rdSKKDAsgmsangtakatpaaagsssgqassagvappvattvvvqkvceSCpRLEGDLKKLRAELSTHRQTENELRQKY 598 Anopheles gambi...
NP_001071887 400 liSTPSA-------------------------------------------IE-RLEATIAKLQSELNQARKNDQEMKNQI 435 vase tunicate
AAX11923     381 --GKPDA-------------------------------------------LV-RLEQDVKRLKTDLQANRQLESELRSQL 414 spotted green p...
XP_028936675 377 --GKPDA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQELRSQI 410 platypus
Q2TLY1       447 GSLGTSERSIRSELGQLRQENELLQNKLHNAVQAKQKDKQTLGQLEKRLKAEQEARAAAEKLLAEEKKRKKLEEATAARA 526 zebrafish
XP_004082444 429 SSLGSAERSIRTELGQLRQENELLQNKLHNAVQAKQKDKQTVGQLEKKLKGEQEARATAEKQLAEEKKRKKLEEATAARA 508 Japanese medaka
Q2TLY2       412 SSLSSAERSMRSELGQLRQENELLQNKLHNAVQAKQKDKQTIVQLEKRLKAEQEARAAVEKQLAEEKKRKKMEEATAARA 491 zebrafish
AAX11930     429 NLLTNLERAAKNDIIQLKKENDMMQTKMNGMMSSKQKEKQSMQSMEKRLKSEADSRVNAEKLLQEEKRRKREEEDTAKQA 508 Pacific transpa...
XP_015792346 422 NSLLSEERSLKSELSTLQQDNDSLQTRLHNLLSARQQDKQTVSQLEKRLQEEKKSRASYESQLASERKAKKDE----ANA 497 two-spotted spi...
XP_558145    599 DSNTG---NLKSCLQAKQKEYDELQTRYQELSSQRQQERQNLQTVERRLGEERRHRQSLEAQLNNERKYRKQAEEKAAR- 674 Anopheles gambi...
NP_001071887 436 SLLTNLERSAKNDVNQLKKENDMLQTKVNSMVSGKQKDKQSMQSMEKKLKSEADSRVNVEKQLHEEKRRRKEEEETAKHA 515 vase tunicate
AAX11923     415 SSLSSQDRSLRSELGQLRQDNELLQNKLHSAVQAKQKDKQTISQLEKRLKAEQEARTLAEKQLAEERKRKKMEEATAARA 494 spotted green p...
XP_028936675 411 SSLTGTERAIRTEIGQLRQENELLQNKLHNAVQMKQKDKQTVSQLEKKLKAEQEARAFVEKQLVEEKKRKKLEEATAARA 490 platypus
Q2TLY1       527 VALAAATR-GECTESLRRRISELEAECKKLTLDI-------KVKEDQIRELELKVQELHKY------KENEKDTEVLMSA 592 zebrafish
XP_004082444 509 VALAAASR-GECTDTLRRRITELETECKKLTMDI-------KLKEDQIRELEIKVQELHKY------KENEKDTEVLMSA 574 Japanese medaka
Q2TLY2       492 VALAAASR-GECTDSLKSRIRELESECKKLTHDM-------KLKEEQIRELELKAQELHKY------KENEKDTEVLMSA 557 zebrafish
AAX11930     509 AAQAITSReRERAEVLKQAKQDLELEIQRLETKL-------RIKEEECAALK---KEIVDYqv---qEKSVKESETLMSA 575 Pacific transpa...
XP_015792346 498 RAAAAAAR-IECTEICKNKRRELESELKLLRKEI-------KVREDQVKQIDCEAQSLRQY------KESHGDTEILLSA 563 two-spotted spi...
XP_558145    675 ---------SECGESCKMKKQQMEMEIDKLQHEVinaeegkLMAEKQARNYE---QEMRKYelqlrsRESQPNTEVLISA 742 Anopheles gambi...
NP_001071887 516 AAQAQNNReKEKAEALKQAKHDLENEILKLEGQL-------KAKQEECDVMK---KEISEFql---qEKSAKESETLMSA 582 vase tunicate
AAX11923     495 VALAAATR-VESTDSLRSRIRDLETECKKLTMDM-------KLKEEQIRDLEGKCQELRKY------KENEKDTEVLMSA 560 spotted green p...
XP_028936675 491 VAFAAATR-GECTETLRSRIRELEAECKKLTLDM-------KLKEDQiRELEIKVQELRKY------KENEKDTEVLMSA 556 platypus
Q2TLY1       593 LSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKD-------LKQKIAEVMAVMPSvvysadT 665 zebrafish
XP_004082444 575 LSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQMIQKDQEIKD-------LKQKIAEVMAVMPSisyttdT 647 Japanese medaka
Q2TLY2       558 LSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKEQEIKE-------LKQKIAEVMAVMPSitysaeT 630 zebrafish
AAX11930     576 LQAMQDKNLMLENSLSAETRLKLDLFSALGDVKRQLELAHGAIYKRDAEIVD-------LKSRLADILSILPE------- 641 Pacific transpa...
XP_015792346 564 LSAMQDKNAHLENSLSAETRLKLDLFSALGEAKRQLEINQALLQQKERQIEElestvdqLKARFTELLAVMPA------T 637 two-spotted spi...
XP_558145    743 LAVMREKNETLEKNLSAETRVKLDLFSALGGTRREVEILTCSLRSKEKEILD-------LNAKIVQLVAVMP-------- 807 Anopheles gambi...
NP_001071887 583 LQAMQDKNLMLENSLSAETRLKLDLFSALGDVKRQLELAHGAIYKRDAEIVD-------LKSRLADILSILPE------- 648 vase tunicate
AAX11923     561 LSAMQEKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIHQREQEIAE-------LKQKIAEVMAVMPSlsyssdG 633 spotted green p...
XP_028936675 557 LSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIIQKDQEIKD-------LKQKIAEVMAVMPSitytaaT 629 platypus
Q2TLY1       666 GSMTPVTPHYSSKFMDTSPSGLDPNASVYQPL 697 zebrafish
XP_004082444 648 SSMTPVAPHYSSKFMDTSPSGLDPNASVYQPL 679 Japanese medaka
Q2TLY2       631 NNMTPVTPHYSSKFMDTSPSSLDPNASVYQPL 662 zebrafish
AAX11930     642 SRIRSPTPHYSANFLEKPPLVRLSPTQEYPNN 673 Pacific transparent sea squirt
XP_015792346 638 NAYTGIDSDIVSSLMLNSKFMPDPNDS--HES 667 two-spotted spider mite
XP_558145    808 NDALGLTSHGGGGGTDGSSMMRladapql--- 836 Anopheles gambiae str. PEST
NP_001071887 649 SRIRSSTPHYSANFLEKPPLVRLSPTQEYPNN 680 vase tunicate
AAX11923     634 SNLSPVTPHYSSKFMDNSPSSLDPNASVYQPL 665 spotted green pufferfish
XP_028936675 630 STLSPVSPHYSSKFVETSPSGLDPNASVYQPL 661 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap