Conserved Protein Domain Family
A_thal_3526

?
pfam09713: A_thal_3526 
Plant protein 1589 of unknown function (A_thal_3526)
This plant-specific family of proteins is defined by an uncharacterized region 57 residues in length. It is found toward the N-terminus of most proteins that contain it. Examples include at least several proteins from Arabidopsis thaliana and Oryza sativa. The function of the proteins are unknown.
Statistics
?
PSSM-Id: 401595
View PSSM: pfam09713
Aligned: 42 rows
Threshold Bit Score: 60.6761
Threshold Setting Gi: 75123241
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDY28949          12 NKVKECIDKYlMSKEETERYLEDQQGITRQDTNMAWIILERMHPDLFTSYY 62  rape
XP_651545         94 SNIEQYLQFY-YTDDEIVREL-EKKSVQRETTLYILTKLKEQNPGYFKAYE 142 Entamoeba histolytica HM-1:IMSS
XP_004358839      17 NCIEKCFSLY-MTKTEIILTLQNQRNVSPSFSETMLANLEASNPDFFKIYY 66  Cavenderia fasciculata
EGC35384          13 KSIEKCFTLY-LTRAEIMLALQNQFNVNPEFSENLLNNVEHNNPDFFKVYY 62  Dictyostelium purpureum
Q54EP4            13 KAIEKCFSLY-LSRAEIMLMLQHQFNVNPEFLESLLNNIEQTNPEFFRVYY 62  Dictyostelium discoideum AX4
EFA83070          78 QCIEKCFTLY-LTRTEIIITLQNQFGVNPSFSEAMLLNLEAKNPDFFDIYY 127 Heterostelium album PN500
Q1PFB1            24 YRVEECIQGY-MSKEETASFIFDTFGVSLKFTRFVWYLLEKANPDFFRCFK 73  thale cress
CDY51040         505 DEIERCIKKY-MNLEQTITYLHEKYHIHHVITSAIWERLQEGNPDFFEEYY 554 rape
JCVI:AT2G29605.1  27 NIIATCIRKY-MSLEETVNYMQENHKISHHLTKPIWEQLQKENADFFNKYH 76  thale cress
RID67436          47 NRIELCIQNY-MSLEVTAKYLEKNHRISKSVTHIVWEQLREENPVFFSHFE 96  field mustard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap