3TOC


Conserved Protein Domain Family
Cas_Csn2

?
pfam09711: Cas_Csn2 
Click on image for an interactive view with Cn3D
CRISPR-associated protein (Cas_Csn2)
CRISPR loci appear to be mobile elements with a wide host range. This entry represents proteins found only in CRISPR-containing species, near other CRISPR-associated proteins (cas). The species range so far for these proteins is pathogenic bacteria only. Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats).
Statistics
?
PSSM-Id: 401594
View PSSM: pfam09711
Aligned: 7 rows
Threshold Bit Score: 179.129
Threshold Setting Gi: 81412820
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3TOC_A    41 QYEEDSELKFFDHKXKTIKESEIX-LVTDILGFDVNSSTILKLIHADLESQFNEKPEVKSXIDKLVATITELIVFECLEN 119 Streptococcus pyoge...
Q8E039    38 QYDVDEHLKLFDDKQKSLKATELM-LVTDILGYDVNSAPILKLIHGDLENQFNEKPEVKSMVEKLAATITELIAFECLEN 116 Streptococcus agala...
CDE28387  40 LYDKNKSTELLVIDGEKNITTNIL-LITDLYKIDFNDKNLLKEIYSQISKSITSDEEKCMRYQELVDDLSAILENELEDY 118 Catenibacterium sp....
Q8DTE6     7 QYDEDSELKFFNRKFKSLKPSELM-LVTDILGYDVNAPSLLKLVHADLENQFNEKPEVKSMVEKLANTITELIAYECLEN 85  Streptococcus mutans
BAO05879  38 TYKENGEVKLFNERHETIKESELM-MITDILGFDINSAATLKLIYSDLERQLNEKPEVKSMITKLTDTISELIEYELLDH 116 Enterococcus mundti...
EOU03964  37 QYGENSMLKFFNDKLQLLKPSELI-VVTDILSFDSQAPTTLKLIYADLEQQLNENIELKSRIDQLTTKVQEWISEELLEH 115 Enterococcus hirae ...
Q73QW3    40 QYSGNEGKFILSEDDKELSIPKTCeLILNPINLDINNKQNLNKIYSILKQSISDEYNYLKTCT-IKSEILKHIDDVLLSL 118 Treponema denticola
3TOC_A   120 ELDLEYD-EITILELIKSLGVKVETQSDT-IFEKCLEILQIFKYLTKKKLLIFVNSGAFLTKDEVASLQEYISLTNLTVL 197 Streptococcus pyoge...
Q8E039   117 ELDLEYD-EIKILELIKALGVKIETQSDT-IFEKCFEIIQVYHYLTKKNLLVFVNSGAYLTKDEVIKLCEYINLMQKSVL 194 Streptococcus agala...
CDE28387 119 NLEFDYKnDLTIENYLKAVSLKISRKAEEkLYDRLMNYVELVTELVKKPVLVLYNCFDYLDDEELMELIKYKNYKHLHLL 198 Catenibacterium sp....
Q8DTE6    86 ELDLEYD-EITILELIKALGVKIETQSDT-IFEKMFEVLQVYKYLNKKKLLVFINTLSYFKREEIAQILEYIHLSDMVVL 163 Streptococcus mutans
BAO05879 117 EMDLESD-EITILELFKALGVKIETTSDT-IYEKIIEILQVFKYLTKKKLLIFINVCSYLTLKEIEEIRSYISLCNMDVL 194 Enterococcus mundti...
EOU03964 116 ELDLVCE-EMSMVELFKALKIRITTQPES-IFQKIMEILQIYKYLVKKKCLVFINVGAYLTTTEMAELQEYISLCHMPVL 193 Enterococcus hirae ...
Q73QW3   119 DIPLKRSeELDLISIFKAVNISFETEYTN-LLEKIIDYISASVELNQIKCFIFINLKQFLHFKDLSELYKFACYIKTNLF 197 Treponema denticola
3TOC_A   198 FLEPRELY----DFPQYILDEDY 216 Streptococcus pyogenes serotype M1
Q8E039   195 FLEPRRLY----DLPQYVIDKDY 213 Streptococcus agalactiae serogroup V
CDE28387 199 FIENKNREvdsiAFRKYIIDEDL 221 Catenibacterium sp. CAG:290
Q8DTE6   164 FLEPRKID----GFAQYILDEDY 182 Streptococcus mutans
BAO05879 195 FIEPRKIA----GITQTILDNDY 213 Enterococcus mundtii QU 25
EOU03964 194 FIEPGKIK----GLKQTVLDQDY 212 Enterococcus hirae ATCC 9790
Q73QW3   198 LIEGSYTStkedCEKSYIIDKDL 220 Treponema denticola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap