Conserved Protein Domain Family
Wx5_PLAF3D7

?
pfam09688: Wx5_PLAF3D7 
Protein of unknown function (Wx5_PLAF3D7)
This set of protein sequences represent a family of at least four proteins in Plasmodium falciparum (isolate 3D7). An interesting feature is five perfectly conserved Trp residues.
Statistics
?
PSSM-Id: 401577
View PSSM: pfam09688
Aligned: 11 rows
Threshold Bit Score: 142.556
Threshold Setting Gi: 74863443
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAQ41781      91 FKRNLAQDYYDNVPevPEENVLEPDDATTETVEFHNSSYpleeDELDDSENLDELIEACEKEFEDILIDITDQFVEFTDD 170 Plasmodium know...
XP_001612949  51 EKKTDKEKKTDREK--KTDREKKTDREKKTEGGKKTDKE----KNAQSAEELTLLCIKTSRMWKESIKEMENMYKENTKN 124 malaria parasit...
EDL47221      19 FERIMAETLVHQPY--KEDFAIGTRIKHNSAYNTESD------DTSAHSEELKQLCTKISSIWKESVEDMEKEYNEKTQQ 90  malaria parasit...
XP_002261911  46 FGRIMAETHVNQPY--KEDFSIGTKAEQNSLYNTKSD------DTNVYSDELKALFTKVSSIWKESIEDMEEEYYEKTQQ 117 Plasmodium know...
Q8I2F8        47 NERILSEQHDENDW--RNEFSVVINLK-----NIPEEQQlgeqQEPEYIYELNDLCKRASEYWKNAISDMEEEYKELTKY 119 Plasmodium falc...
XP_001616031  91 FKRNLAEESYDNVPgvPEENALEPEDATTQTLEFYNSDYpleeDELDDIANLDLLIESCEREYDDILLDITNRYVEFTDD 170 malaria parasit...
Q8IIX2        25 YDRILTEH---VKHlwKNNFSLEVNTSQKNPSSLK--DHvssnQSTEEIKKTNELITNLSKLWKDMIKNTEEEYNHNTDH 99  Plasmodium falc...
O96126        92 YQRIIVER---EDViwKQDFKITLNEKSYERLNLPTEKQipysTCSEEIEKVHNLTTRVTEIWKLLLEQMEVKYLIKTDN 168 Plasmodium falc...
Q9U0N3        46 FKRIIAEASEEQKYpwEEDFCLILNEE--ELIRPEHNDSpylpEHYENIDKINELSINSTKIWKETIKKMRQNYEKETDN 123 Plasmodium falc...
XP_001616481  83 NGRTLAEKETSKAQ--EEGFFTFENEKDE---KLRRDGSpy-lKVYTNINDLNNLSVNSFKIWKNVIQNMKNHYYKETVN 156 malaria parasit...
CAQ40593      83 NGRILATNETFNEE--EKNFFTFKDENDE---KLRRDDSpy-lKVYTNINDLNDLSVKSSEIWKKVIQNMKDYYYKETVQ 156 Plasmodium know...
CAQ41781     171 MNHYWCDKMWEIVWCK-YADNVYTSVMKNLQDPKLSLNEKKNIFKFLMEWFRKDFKCFLKLIKEEWD 236 Plasmodium knowlesi strain H
XP_001612949 125 MDAKWSSNIWNTVWAV-YVENVHNIIGSKLNMPDFPLRDKEKIIETWLNWTKTDFHVFLNQVQARWN 190 malaria parasite P. vivax
EDL47221      91 VEKSWREGIWNNKWAK-YLEHVHNTIQVKLNDLSKTPHDTEVNIAFMLSYVISVFAMFIEEVVEDAT 156 malaria parasite P. vivax
XP_002261911 118 VEKSWRENIWNNKWAK-YLEHVHNTIQKKLNDLSNTPHDTEVDIAFMLSYVYKVFEMFIEEVIEDAK 183 Plasmodium knowlesi strain H
Q8I2F8       120 MDQNWTKDMWNREWVK-YLRRVYGHILSDINDPSLTLVDKEYIVNIWITWTRKDFRFFLEYTKESWE 185 Plasmodium falciparum 3D7
XP_001616031 171 MNHYWCDQMWKKRWCK-YADSVHTEMMSNLNNPNLTLDEKKESFKILMGWCEDDFKYFLKLIKQEWD 236 malaria parasite P. vivax
Q8IIX2       100 MDHKWRDDMWNKQWGK-YLDAAHDNINKHLRNYNSSEDYKKDITNKWIQWASEDVEVFVNALKQEWY 165 Plasmodium falciparum 3D7
O96126       169 MNHKWRDFMWESKWAL-YLENVYKFINDKLNEPHVSIVEKETFIQKWFINTSHDYNYFLNFVFERWK 234 Plasmodium falciparum 3D7
Q9U0N3       124 MNHNWRDFMWHYKWANiYLYKVHKLINITLKDLTNPIHDKEETITTWIKWIQEDIEYFLFNLQVEWL 190 Plasmodium falciparum 3D7
XP_001616481 157 MDDRWRHYMWHMIWEKhYIQNVQRLINKALQELNNPVTKKEKIINNWFQASEEGLEVFLNCVKEQWD 223 malaria parasite P. vivax
CAQ40593     157 MDDRWRDFMWTMKWKKhYIQNVHSMINKVLQDLNNPITEKEKIINTWLQISEQDLEFFLKCVKEQWH 223 Plasmodium knowlesi strain H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap