Conserved Protein Domain Family
Phage_rep_org_N

?
pfam09681: Phage_rep_org_N 
N-terminal phage replisome organizer (Phage_rep_org_N)
This entry represents the N-terminal domain of a small family of phage proteins. The protein contains a region of low-complexity sequence that reflects DNA direct repeats able to function as an origin of phage replication. The region is N-terminal to the low-complexity region.
Statistics
?
PSSM-Id: 401570
View PSSM: pfam09681
Aligned: 10 rows
Threshold Bit Score: 154.458
Threshold Setting Gi: 499794893
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y4W2         6 WIKLSVNMFDDEKIKLLEKMPEGNQMLIVWIRLLALAGKTNDKGRIYLNENVPYTEDMLATLFNRDVGIIRVTLHTLQSF 85  Listeria monocy...
Q97HS4         6 WIKIVVNIFDDEKIKLIEKMPEADALLVIWFKILCLSGKTNRSGLLMLSDKIYYTDEMLSSLFNRPLNTIRLALETFKKF 85  Clostridium ace...
WP_012103631   6 WIKITTTMFDDEKIKLIDAMPERDTIFYIWMRLLVQAGKTNAGGYIFLTEDIPYTDEMLSAIFNRPLNTVRLALDTLKKF 85  Clostridium klu...
Q2FUP6         6 WIKLKVGMFDDSKIKYIEALPERDTIITIWVKLLTLSGKYNEQGYIMLSENLPYNEEMLANEFNRPINSIRLAIQTFETL 85  Staphylococcus ...
WP_012468935   3 WIKIMCNILDHRKIKMIRKGPEGNTLVLLWLLMLAEAGKCNRGGYLMVSDSLPYTAETISMVTDIALPTVQLGLTIFAGL 82  Geobacter lovleyi
Q8E106         9 YLKLKENFFESDEAIILESMPDGYIYSNILLKLYLRS--LKNDGLLMFNNLIPYNAQMLATITRHQVGTVEKAIQIFRDL 86  Streptococcus a...
Q03VK8        13 WIKIRQDFFTDPYIKLLRRMAGGDTYTIIYLKMLVKS--ADTNGTIYFQGAGQDLAEELSLMLDEGVEDVRALLAYLEAK 90  Leuconostoc mes...
WP_011475627   8 WIKLQMDFWKSPVVKMLRKPSGGDTYAVIYLEMILLS--LENNGYIYYSGVGDSFAEEIALVLDEETINVEFVLAFLKQK 85  Lactobacillus s...
KEI77014      15 WIKITTNMFDDEKIKLIDAMPERDTVHYIWMRLLVQAGKTNSNGYIFLNDNVPYTEEMLSTIFNRPLNSLRFALKVLRDF 94  Clostridium bot...
WP_012047606  10 WIKIVTDIFDDEKILLIENMPEADSIIVIWFKLLCLAGKMNNSGVFMLNEKIAYTDEMLATIFRRPLNTVRLAINTFQQF 89  Clostridium bot...
Q8Y4W2        86 GMIQK-TeNGLIEIEN--WEKHQNVDGMERVREQTRKRVEKHRE 126 Listeria monocytogenes
Q97HS4        86 GMIEI-I-NDAYYITN--WEKHQNIETLDKVREQTRLRVKKYRE 125 Clostridium acetobutylicum
WP_012103631  86 GMIQR-SeNNDLKITN--WDKHQNVESMDKIREGNRLRKRRQRE 126 Clostridium kluyveri
Q2FUP6        86 GMIEK-V-NGVIKVTN--WEKHQSLDSKAKHKEKNKLRQQRYRE 125 Staphylococcus aureus subsp. aureus NCTC 8325
WP_012468935  83 EMIDQ-Q-DGIIFIAN--WSKYQSEDKLEKRRENDRERKQRHRK 122 Geobacter lovleyi
Q8E106        87 QLIEI-LdNGAIYMTN--IQNFVGKSSTEADRIRKLRAKNNSGV 127 Streptococcus agalactiae serogroup V
Q03VK8        91 KLILHpDfTEDIYLVA--TPDLTGSETGSAKRVREFRARQKQKT 132 Leuconostoc mesenteroides subsp. mesenteroides ATCC...
WP_011475627  86 RLIEF-SdDTSFKFTEdvTADLVGSESASAHRVRAYRKRQKTIA 128 Lactobacillus salivarius
KEI77014      95 GMIQI-QeDKLIKIAN--WSKHQNIEGMEKVRQQTRERVAKHRa 135 Clostridium botulinum B2 128
WP_012047606  90 GMIEV-I-DNVITIPN--WSKHQTLDQLEERKEYMREYMKGYRE 129 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap