Conserved Protein Domain Family
RE_Alw26IDE

?
pfam09665: RE_Alw26IDE 
Type II restriction endonuclease (RE_Alw26IDE)
Members of this entry are type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family. characterized specificities of the three members are GGTCTC, CGTCTC and the shared subsequence GTCTC.
Statistics
?
PSSM-Id: 401559
View PSSM: pfam09665
Aligned: 4 rows
Threshold Bit Score: 745.543
Threshold Setting Gi: 122381545
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1ATV9                   16 EYQKFIVEHPNYAGMPDVRGVSGDIQWEAPSNRKSGrfrdtyRKRDAWWAEKAREVGIDPS---SNQWISRTAKKIHPTG 92  Rubr...
WP_058027864             27 EYMVFMATNEIYANMPDAIKSDGKIQWEAPSNRSGGlyqythQHRLEWWQEKAKSEGIDVN---QNQWISKTAKLIHPTS 103 Colw...
GAP71827                 43 DYTEMIVNHPSYKGLLYERKADGRVKWGAAGKSDKG------QLRRQWWDEQCTTAGIKV----EAGCYAKIAVAIHPTK 112 Cand...
PRJNA290651:AEM51_00570  92 KYQEFIATHNNYKGMPLKRRSDGTIQWVSTIQTNDG------KERVEFWENKRKELKIKANhvlDAGFRQKVAFANHPTK 165 Bact...
Q1ATV9                   93 EKPCKVCGRVLDIAYAYPNRHLIGRLQRLpyvdesFP----IDPLEHISSLVT-------RMVEQFGDSVFEELPALLGT 161 Rubr...
WP_058027864            104 EKPCKRCGKFMFIKYMYPSHILLKRINKL------FPdeikVKIFDTILNVVS-------DLYETNGDTVLRNLPSLLKA 170 Colw...
GAP71827                113 KHVCQICGKTLSVEYVYPDKRTLTALNQKlsa-diKPytltIFEIID---------------KYGVSSSAIENIKSAFKI 176 Cand...
PRJNA290651:AEM51_00570 166 IHICLFSGSELYIDYRYPSPSRIDLLNKVydq-dlKYydldVYEIANLLYDVDgcrlfcdVFKLSKEFSNVEQLIEILKV 244 Bact...
Q1ATV9                  162 kwisvpelePRLEVWLKWIAEEYIPHEPSVLSPGVMSNAPDRLDGFHSFNICCRGIRDKGRSKENLQSYTTDRRVFEYWV 241 Rubr...
WP_058027864            171 knisipelgDNLDDWLAWIEESYIPAEPSTLSPGAMSNAPDRFEGFHSFNKCCRGQADKGRSDKNLRSYTTDRRVFEYWA 250 Colw...
GAP71827                177 ---------EGCTATKAQLGDYIFKNCQTHLSPGVMSNSPDRFDGFHSDGSCCRGTSDKGRHKENLQRYSQDRRVYENWA 247 Cand...
PRJNA290651:AEM51_00570 245 --------------------DYVIAEYSPFVSPGVMSNSPDRFDGYHSYNNDVRAITDTGRYKDNLKRYTQDRRVYEMWS 304 Bact...
Q1ATV9                  242 DGDWVAADRLMGIIrsddelkrepclngHPGPCSADHIGPISLGFAHRPEFQFLCKACNSGKNNRMYASDVEHLRRKSDE 321 Rubr...
WP_058027864            251 DGDWIAADRLMGQVssnmrd--epcadgGEGPPSPDHIGPISLGFCHRPEFHLLSKAANSAKNNRMSKWDILHLKEAEKK 328 Colw...
GAP71827                248 DGNWKMADRLMAEF--------------AKHGVSADHIGPISLGFCHRAKFQPMTKSENSAKNNRMSFCDVQTLLADEAK 313 Cand...
PRJNA290651:AEM51_00570 305 GGNWKMADRLYATF--------------VKNGVSPDHIGPMSLGFAHRPKFQPMTSNENSAKGNRMTLSDIQILIADESN 370 Bact...
Q1ATV9                  322 GETVASWYSQKLWELRRDSVVDEETARRLSKLLRDNRHTAMHVLDRFRRSGHHTFLATFLGLHHANHDISFEGLrvEDHR 401 Rubr...
WP_058027864            329 GITICSWYAEPIWNILKDKVKNDEHARRLSKIMRDNQRNAMYLLSQMKTRGEYAFLSYLLELERANFNVEFNSLkaVNYL 408 Colw...
GAP71827                314 GEQVISWHSKYIWDTFKDRITNDTEAVKVSAIMRNNLHQILLIFSIISENGYNDFLTEFLNPQHSFHDYSFKGF--DPQT 391 Cand...
PRJNA290651:AEM51_00570 371 GDEVITWHSKYVWDKLKLKVKNDTDALKLSGLMRKNLHHVLIIFSIINENGHRAFLQQFLNPDFSYFDYEFEKF--NPKT 448 Bact...
Q1ATV9                  402 TRFDNIRKSTRTTEYATEQKARRIRVAFSALRDYVDKESRNALNVCTPAIDEKIAEALSLLDGepldirklddkirsive 481 Rubr...
WP_058027864            409 TVYNELQHSERVVKYSEEQKSRRLRIGFEALDSYSSKENRHTFLVASEQIEFKLVECIDYLNAlgkehvllnesvktaid 488 Colw...
GAP71827                392 GEYKEVKTKNLTGKNQQNNVDRYLRIAFESLEDYKTKDNRKQYGWDNAEIDKNINQTLQYLSE----------------- 454 Cand...
PRJNA290651:AEM51_00570 449 GSFHNVVSKKLEGQNQKNNAERYVRIAFESLDKYRDIENRNTKIWESELITKKVNQVLGLLDE----------------- 511 Bact...
Q1ATV9                  482 qevpseeelrsvvtriptpeeepDTFRDARARLREAMDLVAAEFS 526 Rubrobacter xylanophilus DSM 9941
WP_058027864            489 t----gfdiqlrevvnkvpnlpfKPYEHVKALLVEGMNAVATDLA 529 Colwellia sp. MT41
GAP71827                455 -----------------------GNKEEATKQLKVTFQKLAEIAD 476 Candidatus Symbiothrix dinenymphae
PRJNA290651:AEM51_00570 512 -----------------------KKDDEALLLLHQIFQELSSIAE 533 Bacteroidetes bacterium UKL13-3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap