Conserved Protein Domain Family
PGPGW

?
pfam09656: PGPGW 
Putative transmembrane protein (PGPGW)
Proteins in this entry are putative Actinobacterial proteins of about 150 amino acids in length, with three predicted transmembrane helices and an unusual motif with consensus sequence PGPGW.
Statistics
?
PSSM-Id: 370603
View PSSM: pfam09656
Aligned: 21 rows
Threshold Bit Score: 37.9991
Threshold Setting Gi: 151361529
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6NHR8                  29 SPLLLVAGMCLLIFGIIILPTPAPGWLCIFIALGILSLVHPPTRRLTIWLASK 81  Corynebacterium diphtheriae
jgi:Strop_1601          86 KVFVAITGAIIVTVGIALIPLPGPGWLLVIAGLGVWAVEFHWARRLLTFTRRH 138 Salinispora tropica CNB-440
Q47N26                  83 RVTVGLVGSVVLLGGVVMCVTPGPGIGGVIVGLAILATEFSWARRLLWRARDY 135 Thermobifida fusca YX
jgi:Glov_0553           11 QLVVAVIGITVVIIGIIMIFTPGPAIVVIPLGLGILATEFVWARDLLHKVKTY 63  Geobacter lovleyi SZ
Q3J984                 343 RIVVLVLGTSVLLVGVAMIVLPGPAVVVIPIGLGILAIEFAWARRWLKKIRQT 395 Nitrosococcus oceani ATCC 19707
Q0S1E3                  50 RIAVGVIGALVLAAGIVAIPYPGPGWLIVFAGLGILASEFAWAHRLLHYARQR 102 Rhodococcus jostii RHA1
PRJNA261003:LJ00_14580  32 RSVIGVVGTVVLAVGVVAIPYPGPGWAIVFLGLAILATEFRFAEVALRFIRRR 84  Mycolicibacterium smegmatis MC2 155
Q5YTC9                  35 RIGVGVIGAVVLAIGIIAIPYPGPGWAMVFAGLGILASEFAWAQRALRWLRDR 87  Nocardia farcinica
CAM01270                23 RITLGAFGAVVLLAGIAMIPYPGPGWLVVFAGLGILATEFHWAHRVNLFAKRH 75  Saccharopolyspora erythraea NRRL...
ABS04532                67 RAVVGAVGTFVVLLGLLLVPLPGPGWLIVFLGLAVLGTEFATAQRLKRFGERQ 119 Kineococcus radiotolerans SRS302...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap