Conserved Protein Domain Family
DUF2396

?
pfam09654: DUF2396 
Protein of unknown function (DUF2396)
These conserved hypothetical proteins have so far been found only in the Cyanobacteria. They are about 170 amino acids long and contain a CxxCx(14)CxxH motif near the N-terminus.
Statistics
?
PSSM-Id: 401552
View PSSM: pfam09654
Aligned: 17 rows
Threshold Bit Score: 278.445
Threshold Setting Gi: 158306426
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012306821       9 PIFGAEIPCPHCRQMIPALTLTDSYLCDRHGAFEADPETEILVHLQSSRQWKRWEEKWYRQHTHPDGIRFEIHEALDRLY 88  unclassifie...
Q7NHH8             9 PIFGPEIRCPHCRQWVAALTLTDTYLCQRHGAFEADPETETLVHLQSGRRWRLWEDNWYRQHTHPDGIRFEIHEELDRLH 88  Gloeobacter...
Q2JJH8             8 PIFGPSIQCPHCRQTIAALTLTDTYLCPRHGAFEADAEQEELVHLQSGRRWRFWEGRWFRQHTHADGIRFEIHEELDRLR 87  Synechococc...
Q31LS9             9 PLFGAEISCPHCRQNIPALTLTDAYLCNRHGAFEANPETGELVHLQSGRTWRRWEDQWHRQHTHPDGLRFEIHEALDRLF 88  Synechococc...
jgi:PCC7418_0845   8 PIFGAEIKCPHCRQTIPALTLTDTYLCSRHGAFEADPKTEELVHLQSGRCWRMWEGQWYRQHTHPDGIRFEIHEALDRLY 87  Halothece s...
WP_015220330       9 PIFGPQIKCPHCRQTIDALTLTDSYLCPRHGAFEANPETEVLVHLQSGRQWRLWEHKWYRQHTHPDGIRFEIHEALDRLY 88  Cyanobacter...
jgi:Sta7437_0858   8 PIFGPEIKCPHCRQVISALTLTDTYLCPRHGAFEANPDTEELIHLPSGRRWRRWENQWYRQHTHPDGIRFEIHEALDRLY 87  Stanieria c...
Q8DGF0             9 PIFGPEIRCPHCRQIIPALTLTDTYLCPRHGPFEADAKTGELMHLQSGRIWRLWEGEWYRQHTHPDGIRFEIHDALDRLY 88  Synechococc...
WP_015161208       8 PIFGPEIQCPHCRQTIPALTLTDTYLCSRHGAFEANPHTGELVHLQSSRHWCLWDGEWYRQHTHPDGIRFEIHDALDKLY 87  Chamaesipho...
jgi:Pse7367_0108   7 PIFGAEIQCPHCRQVIPALILTDTYLCPRHGAFEAKPDTHDLVHLQSERHWRLWEGEWYRQHSHPDGIRFEIHECLDRLY 86  Pseudanabae...
WP_012306821      89 TQGLRATKITIAQRYQTLMRRTL-------DFKSApgRGDitstDyavtPsVPHLYGLPVFFHDAGDRQ-----DRWQIV 156 unclassifie...
Q7NHH8            89 TQGYRATRVVVAERYRELISTFL-------ERTTF--GRS----Ed---A-RHRLYGLPVEFSGAADQD-----GRWSVI 146 Gloeobacter...
Q2JJH8            88 MQGMRATQVIVAERYRQLLTPYL-------EQGSH--RR----------PgPPRLYGLPVSFSSQIPEDrggspQRWRVI 148 Synechococc...
Q31LS9            89 SQGQHAVRVTIADRYRELLRSYW-------QRSGG--LGAaacsEh-------RIYGLPVQFSPSPKED-----PCWAVI 147 Synechococc...
jgi:PCC7418_0845  88 TQGYRATRVIIAKRYQELVSSYL-------EKHRS--RWGd--sT----EnQLRLYGLPIAFSPDEVED-----PRWGVI 147 Halothece s...
WP_015220330      89 TEGYRATKVIIAERYHNLISSYL-------DKGNN--WQGn--qE----SkLYKLYGLPVEFSHKSDAE-----PCWEVI 148 Cyanobacter...
jgi:Sta7437_0858  88 TEGYRATKVIIASRYKDLVNAYL-------ERSHP--WREn--gD----SkIPKLYGLPVVFSSETPAD-----PCWEVI 147 Stanieria c...
Q8DGF0            89 TQGYRATKVIIAERYRDLFCAYL-------ERSTP--WRGa--tD----GqMLRLFGLPVEFSPPASQE-----ERWDVI 148 Synechococc...
WP_015161208      88 TQGFRATKVIIAERYRELIGSYLvgeassrDRHHS--WTGa--tEq---PvLPRLFGLPVEFSPAANTE-----PCWKVI 155 Chamaesipho...
jgi:Pse7367_0108  87 TQGFRATKVIIADRYQELVSAYL-------ESNPI--DRT-----------TQRLYGLPVEFSPTGEQE-----PRWQVI 141 Pseudanabae...
WP_012306821     157 NFELETEPGSPRRYPYHYL 175 unclassified Synechococcus
Q7NHH8           147 NFELVKEPGPPLKYPYFRL 165 Gloeobacter violaceus
Q2JJH8           149 NFELTYEIDPAMRQPQSRL 167 Synechococcus sp. JA-2-3B'a(2-13)
Q31LS9           148 NFQLESKDGALLRYPHFRL 166 Synechococcus elongatus PCC 7942
jgi:PCC7418_0845 148 NFDLEKEPGVPVRYPYFRL 166 Halothece sp. PCC 7418
WP_015220330     149 NFVLEKEKGTPSRYPYFRL 167 Cyanobacterium aponinum
jgi:Sta7437_0858 148 NFSLEKEPGVPRNYPYFRL 166 Stanieria cyanosphaera PCC 7437
Q8DGF0           149 NFDLEKEPGAPIRPPYFRM 167 Synechococcus elongatus
WP_015161208     156 NFDLEKEPGIPIQYPYFRI 174 Chamaesiphon minutus
jgi:Pse7367_0108 142 NFELEKEPGAPSKYPQFRP 160 Pseudanabaena sp. PCC 7367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap