2H4O


Conserved Protein Domain Family
YonK

?
pfam09642: YonK 
YonK protein
YonK protein is expressed by the bacterial prophage SPbetaC. It is a 63 residue protein that associates into a homo-octamer in the form of a beta-stranded barrel with four outer helical features at points of the compass. Its function is unknown.
Statistics
?
PSSM-Id: 401542
View PSSM: pfam09642
Aligned: 5 rows
Threshold Bit Score: 66.0123
Threshold Setting Gi: 868707522
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H4O_A             3 S-KKVHQINVK--GFFDXDVXEVTEQTK--EAEYTYDFKEILSEFNGKNVSITVKEENELPVK 60 
Q5HMK6             2 A-QITNSISFKn-AIIDLENNQIIELNK--DTEQQYSLSEVFSRFQDKYVSLTIKENSELGFE 60  Staphylococcus epidermidis R...
O64074             2 AsKKVHQINVK--GFFDMDVMEVTEQTK--EAEYTYDFKEILSEFNGKNVSITVKEENELPVK 60  Bacillus virus SPbeta
IITBIO:IJ22_19190  2 A-KKNNSIAFK--GLLEIETMEITEEDK--NGIFVYDLLAALKEYDGKQVSLTIKEENPVQPK 59  Paenibacillus naphthalenovorans
AKO91923           2 A-KNQDTMSSNltGVLDVEEMTVTFIDKkdEGETVYDLEKTLQKYNGHTVSITFKVDENIDPV 63  Bacillus filamentosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap