Conserved Protein Domain Family
DUF2027

?
pfam09640: DUF2027 
Domain of unknown function (DUF2027)
This protein domain is of unknown function. though putatively involved in DNA mismatch repair. It is associated with pfam01713.
Statistics
?
PSSM-Id: 401541
View PSSM: pfam09640
Aligned: 37 rows
Threshold Bit Score: 164.282
Threshold Setting Gi: 524133057
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCX43753               105 LTVAFEPVNILELSTTTFDAFLVNDSNYYVDYSLCFKPKEseEWTLFAAGTVEPNIQILLGNVDRSTFPKFDSLMLQAIA 184 Prevo...
CDA21586                99 LYLAFVPESCSRLGSTTFDAYLINDSNYYLDYLYAGSDETg-EWTMYSRGTVEPNVQVHLESFGQDSVNRFGRISVQAVA 177 Bacte...
CCX48890                97 VVLAYEPREIKHINTTEFDAYLVNDSNYYLYFTYLTRSDAdrGWTTRYAGIVEPNIQVWLGEVLRSDIPHMERIAVQLIA 176 Bacte...
CDE56666                98 IVLGWESGDLRHIGASGYDCYLINDSNFYLDFVLMAQRDGedVWNTIYTGTVEPNIQLLIGEHTSEDVSALDHIRFQALA 177 Prevo...
CDE40763                98 VVLGYEPGEAKHLNTTTFDAYLVNDSNYYLYVVYATRGDSr-EWTRRFSGIVEPNIQVHLEELRHEDLPERERVAVQYVA 176 Prevo...
Q7MV27                 128 VYLAYLPMNEQRLGTEPYECFLINDSNYCLQYNYLSLMST--GWKIRATGSIDPNTKLFIEEFTAADLQDMERICLQLTA 205 Porph...
WP_022316471           105 LYLGFVPKDKQNISKTEFFMYLINDCNFFLSFTYSLQQGD--DYKLLAHNVLEPNTKLLISKLTLDDVQDFQNGAIQINA 182 Prevo...
jgi:Palpr_1545          98 ALLAFFPVDIKQLQTTSYECYLVNDSNYYLYYNVINGEND--VWASAASGLIEPNMQELLTEISKDQLSSWEKIRVQLLP 175 Palud...
PRJNA240267:FH5T_02685  91 FYFCFVPTDPKNPLSGEIELFLVNDSNYTVLFNYSYIKTD--GVEAIKQGTVRSNSREKIDALVQEDFTDLPDFGFQLIY 168 Draco...
CCZ10828                77 lFIGIVPDNFQNLAASRFEIYLINDAASTCLYSAGYFNGE--KYTALSAGNCNPDATILLGTYTLKELDSVKSLHIQAIY 154 Odori...
CCX43753               185 YKRSK-SFVMKPAMTSRAQLDTTKFCKLHCFTQSTYFDTRVLSIDF-------VSDDETLRRnKPVDAKG----LEEKMM 252 Prevo...
CDA21586               178 YKRGK-SYACKEPVSTVLRIDPVKFYKLHTFGPGEFFEEKAWVLPL-------IENDLPAGD-IPVDAKS----LERAMQ 244 Bacte...
CCX48890               177 FKRDK-EFAIKNPIAVETPFDNTKFFKLHCFHDNIYFDSPVIAVDI-------VKNDVPVKR-LSIDSSR----IEDAIK 243 Bacte...
CDE56666               178 YKQGR-TFRPKTPLDVCINIDTTKFFKVHCFRPNEYFDTPVLATAL-------VSNDVPADN-AAKRADDtakaLRRALE 248 Prevo...
CDE40763               177 FKSDK-AFRLKNPAAVEFRLDATKFYKTHCFHDNMYFDNPVIAYDI-------VKNDVPQRQ-MVIDSGE----LERAMR 243 Prevo...
Q7MV27                 206 YKERK-TFLLKPALSVELRFDTIKFVKLHCFIENDFFEDKALVYPM-------VEDDRPVVE-KVFDPES----IEQAMK 272 Porph...
WP_022316471           183 YKTDK-PFKLQPSLDVKLKVDPVKFYKLHTFRENDFFDEDALVMSV-------VENGVPMKT-LTIEADD----LKEKII 249 Prevo...
jgi:Palpr_1545         176 FKQGK-NYTPQSVVDVNMKINAVKFYKLHSFTASEYFDEPALIVDInsekekeIENKKMAD----ISPED----IKQAMF 246 Palud...
PRJNA240267:FH5T_02685 169 FRETEsEWNL--PMVKKFRVNPVKFYKESTFRANSYFRKNAFVLKI-------TSDTFQTEL-DKLTQDD----FKKVVK 234 Draco...
CCZ10828               155 YKKGN--YSPRPVIDTHVKLNLTSLCKTGNYKHTKWFGPMSFLKPL--------DQKQAIEE-IEIDPEE----LIQAEK 219 Odori...
CCX43753               253 QqKKRVDRR 261 Prevotella sp. CAG:1031
CDA21586               245 E-KKVPQPQ 252 Bacteroides sp. CAG:144
CCX48890               244 A-KKAADRQ 251 Bacteroides sp. CAG:927
CDE56666               249 D-KKRADRR 256 Prevotella sp. CAG:873
CDE40763               244 E-KKAADKA 251 Prevotella sp. CAG:279
Q7MV27                 273 A-KELIDRT 280 Porphyromonas gingivalis
WP_022316471           250 E-KQRIEIT 257 Prevotella pectinovora
jgi:Palpr_1545         247 T-KGETDRP 254 Paludibacter propionicigenes WB4
PRJNA240267:FH5T_02685 235 A-KETAEAP 242 Draconibacterium orientale
CCZ10828               220 V-KKAAESV 227 Odoribacter sp. CAG:788
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap