2HG7


Conserved Protein Domain Family
XkdW

?
pfam09636: XkdW 
Click on image for an interactive view with Cn3D
XkdW protein
This protein of approx. 100 residues contains two alpha helices and two beta strands and is probably monomeric. It is expressed in bacteria but is probably viral in origin. Its function is unknown.
Statistics
?
PSSM-Id: 401538
View PSSM: pfam09636
Aligned: 4 rows
Threshold Bit Score: 140.147
Threshold Setting Gi: 81385750
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HG7_A     1 MILYDAIMYKYPNAVSRKDFELRNDGNG--SYIEKWNLRAPLPTQAELETWWEELQKNPPYEPPDQVELLAQELSQEKLA 78  Bacillus subtilis
P45939     1 MNIGEAILFKYPTADPTKDFIVQNNGDGtpSYIAEWNIRAPIPTEAELKTWWEELQSTSAYEPPVQVDLLARELSQEKLA 80  Bacillus subtilis s...
ABV63403   1 MILYEAIKYQYPDADPQKDFELRNDGDG--SYINEWHLDVPKPTEKELKAWWEESQSNPRYQPPLPLDYLAQEVAKEKLM 78  Bacillus pumilus SA...
Q65KF0     1 MNLALAVKYLFPDAIIGEDFIIRDDGDGrgQYIETWRISAPQPSEKELQEAWENYLENPVTDDP-QLSYTSQQLLK---- 75  Bacillus lichenifor...
2HG7_A    79 RKQLEELNKTLGNELSDIKLSLLSLE 104 Bacillus subtilis
P45939    81 RKQLEELNQTLGSELSKIKLQLLTLQ 106 Bacillus subtilis subsp. subtilis str. 168
ABV63403  79 RKQLEHQCEHLTNELKALKKEILLYK 104 Bacillus pumilus SAFR-032
Q65KF0    76 ----------LGREMSSLKLEILALK 91  Bacillus licheniformis DSM 13 = ATCC 14580
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap