2HSN


Conserved Protein Domain Family
MetRS-N

?
pfam09635: MetRS-N 
Click on image for an interactive view with Cn3D
MetRS-N binding domain
The MetRS-N domain binds an Arc1-P domain in a tetrameric complex resembling a classical GST homo-dimer. Domain-swapping between symmetrically related MetRS-N and Arc1p-N domains generates a 2:2 tetramer held together by van der Waals forces. This domain is necessary for formation of the aminoacyl-tRNA synthetase complex necessary for tRNA nuclear export and shuttling as part of the translational apparatus. The domain is associated with pfam09334.
Statistics
?
PSSM-Id: 401537
View PSSM: pfam09635
Aligned: 4 rows
Threshold Bit Score: 180.023
Threshold Setting Gi: 114794501
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HSN_A  11 KKHPAHLQLANNLKIALALeYASKNLKPEVDNDNAAMELrNTKEPFLLFDANAILRYVMDDFEGQTSDKYQFALASLQNL 90  baker's yeast
Q6CXB8  38 KGHTSALQLANNIKLAYAL-LSSGNLKLEENKDVLIPQLvIDSTGFRLFDANAILRYVLNDFEEEESNEYNFAVSSLEAF 116 Kluyveromyces lactis
Q74Z74  11 KDHSYGFQLANNIKLALAQvLAPAGCTLKVCENEG-PQL-TSGSGFRLFDANAILRFVLNDYEASGSDECQYAQASLEHM 88  Eremothecium gossypii
Q6FTV8  11 KGRDAKVVLANNLKIALAIeLA-KGLKLSINEDRSEPLL--TAGELVLRDANAILRYALDDFEGIHSEQYHYALSSVEAY 87  [Candida] glabrata
2HSN_A  91 LYHKELPQQHVEVLTNKAIENYL-VELKEPLTTTDLILFANVY 132 baker's yeast
Q6CXB8 117 ASHKDPIKEHLAEAVQKSLDNYL-TSVEEPLSATRIVIFANTY 158 Kluyveromyces lactis
Q74Z74  89 LHRSEMVPDYVTTAANKSLEHYL-VSMEEPLSATRLITFANTY 130 Eremothecium gossypii
Q6FTV8  88 LYHQQSSEEHATELVNKMIDNYLkLDKDSKLDAVTLISFANAY 130 [Candida] glabrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap