2HEQ,2HEQ


Conserved Protein Domain Family
YorP

?
pfam09629: YorP 
Click on image for an interactive view with Cn3D
YorP protein
YorP is a 71 residue protein found in bacteria. As it is also found in a bacteriophage it might be of viral origin. The structure is of an alpha helix between two of five beta strands. The function is unknown.
Statistics
?
PSSM-Id: 401532
View PSSM: pfam09629
Aligned: 2 rows
Threshold Bit Score: 144.056
Threshold Setting Gi: 114794350
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HEQ_A  6 LPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV 76  Bacillus subtilis
2HEQ_A  6 LPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV 76  Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap