Conserved Protein Domain Family
HtrL_YibB

?
pfam09612: HtrL_YibB 
Bacterial protein of unknown function (HtrL_YibB)
The protein from this rare, uncharacterized protein family is designated HtrL or YibB in E. coli, where its gene is found in a region of LPS core biosynthesis genes. homologs are found in Shigella flexneri, Campylobacter jejuni, and Caenorhabditis elegans only. The htrL gene may represent an insertion to the LPS core biosynthesis region, rather than an LPS biosynthetic protein.
Statistics
?
PSSM-Id: 401521
View PSSM: pfam09612
Aligned: 3 rows
Threshold Bit Score: 411.646
Threshold Setting Gi: 161789050
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGT48691 462 REVTLVTGFLDIGRGDWDMYR-------RPLETYHQFMETLLTLENNFVVFTDDSSYDFVIKTRTRlgllHKTKVYNITL 534 Caenorhabditis bren...
P25666     3 SSTTIITAYFDIGRGDWTANKgfreklaRSVDVYFSYFERLAALENEMIIFTSPDLKPRVEAIRNG----KPTTVIVIDI 78  Escherichia coli K-12
CAP39771 518 RDVTIVTGFLDIGRGEWDVYR-------RPLETYHQFMETLLTLQNNFVVFTDDSTYDFVVKTRTKlglmEKTKIHKITL 590 Caenorhabditis brig...
EGT48691 535 NDLPlYGYINEAKKIindelNNATFYRTIADVDMKTHPESMSAEYNIVVNSKTYFLHNVTMENPFNSEHFVWLDAGYGHa 614 Caenorhabditis bren...
P25666    79 KKKF-RYIRSRIEKI-----QKDESFTNRLEPRQLKNPEYWSPEYVLVCNLKAYFVNKAINMGLVKTPLVAWIDFGYCH- 151 Escherichia coli K-12
CAP39771 591 NDLPlYGYINEARKIisdelKNETFYRTVADLDMRTHPESISAEYNIVVNSKTHFLHNVTMENPFNSEHFVWFDAGYGHa 670 Caenorhabditis brig...
EGT48691 615 NENFFPYNYNWKPALPDGKISLIKVTPNFDDLSTYDIKKLYRKNVALISGGFIAGDKHSIGQLHSIIHRKFIQLIYQNHV 694 Caenorhabditis bren...
P25666   152 KPNVTRGLKIWDFPFDESKMHLFTIKKGLTVTSQQQVFDFMIGNHVYIIGGAIVGSQHKWKEFYKLVLESQKITLNNNIV 231 Escherichia coli K-12
CAP39771 671 NENHFPYNYYWRPALPDGKISLIKVTPEFDGLSDYDLSRLYRKNVALLSGGFISGDKHSIGQLHSIIHRKFIQLIYQNRI 750 Caenorhabditis brig...
EGT48691 695 DDDQTLLVLAVNSFPQLFHV---IHGDWFDAFRLFAA 728 Caenorhabditis brenneri
P25666   232 DDDQGIFVMCYYKRPDLFNLnylGRGKWFDLFRCFRS 268 Escherichia coli K-12
CAP39771 751 DDDQTLLTLAVNSFPQLFHV---IRGDWFDAFRLFAS 784 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap