Conserved Protein Domain Family
Trep_Strep

?
pfam09605: Trep_Strep 
Hypothetical bacterial integral membrane protein (Trep_Strep)
This family consists of strongly hydrophobic proteins about 190 amino acids in length with a strongly basic motif near the C-terminus. It is found in rather few species, but in paralogous families of 12 members in the oral pathogenic spirochaete Treponema denticola and 2 in Streptococcus pneumoniae R6.
Statistics
?
PSSM-Id: 401516
View PSSM: pfam09605
Aligned: 99 rows
Threshold Bit Score: 86.79
Threshold Setting Gi: 167831918
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Elen_3089         36 VKEVVTAVLFSALMIVVMFVVGSvTMLGvDFSMLFMAATYVLVVAPLYMLMVMRVNRFGVTAFYACVMALVYLMFGNLWY 115 Eggerth...
jcvi:HMPREF9154_2835  23 VRDAVTIGIFIALYIVLFFICGMtMGAI-PLIMVLLPVIFGIFGGLIFMVLLGKVQRTGIFLITGLIIGLMMISMAPGGV 101 Pseudop...
WP_014262050          12 VKDLILIGVMAILLYACMFVVVLiLGMN-PVTYLFAPAISGIPAGIVMMLLLSKAPKKGTFFLASTVVAVFFWIMGRLPL 90  Filifac...
WP_009305896          32 VRDFVTIAVLTVLELVVYFSIGMiAGST-PIGWCFTLGIQAIPLGIIFMLMYAKVNKRGVVLISGVLVGL---LVGM-SF 106 Eggerth...
WP_013251350          12 SRDLIALGVFSLLFMIVSMLVVG-LTSIsVIAYCGCCAIAAIPAGIVWTYMHVRIPRAGTSLVMAAVFAIVVFAVGSGWP 90  Olsenel...
jcvi:HMPREF9154_2829  31 TKDVIMTAALGVLCVAVRMVFMI-AGGIaPLIWLGSHFIDAILLGPVFMLLVAKVPKGGAVFLVCLLTGLAFLNSG--WP 107 Pseudop...
Q73MB3                 9 IKDLIITALMVLCSQILYRILSF-LFMS-PYTMLLTMPIWAIIGAIAYFLVPAKTKNPWMILLFCILTSIIGF----YPP 82  Trepone...
WP_004007231          13 VKDLVTVGVFAAISLAIFIIIGGiAGMT-IFGTVANIPIVCLFTAIPYLLLAGKVKKKGTFLIMGTINVLPGLMVGN-LI 90  Mobilun...
WP_020965768          10 ARDFIGIGIFGAIALLLFFVTGAlAALT-LAGTIANIPIVMFFESIAFMLAALKIRKRGIFLIMGIITVLPGFMAAN-VY 87  Trepone...
Q73R50                10 ARDFIFIGIFAAVALLIFFITGAlAALT-LFGTIANIPITLFFVSIAFMLAVSKVRKTGVFFIMGIIIVLPGFMAAN-GI 87  Trepone...
jgi:Elen_3089        116 MLPFYLV--GGLAIDALFLRTaAqRAKPN---RIVAAWATFsALYSL-SSIIPILVNLQGYLQELAEVrMMGeEYVNAYL 189 Eggerth...
jcvi:HMPREF9154_2835 102 MCYMTIA--GGVVAEVIYWLM-G-HKSFA---SMTAAYTAFvTFFAL-GEYIPFVWMKDAYLELYANN-PTL-DVAKVGM 171 Pseudop...
WP_014262050          91 DVITMLF--CGLIGELLYGAL-G-RKSFR---GMAMAHAVYtCGLTL-VAFISVVLLKDAFAEAFA---MYGeSYISKII 159 Filifac...
WP_009305896         107 WLTGLVIalGALAGEVIWNVA-N-RKRFA---TMAASFTSImVGWYL-GAFAPLVLMKDFFLNSVPTMa----EFYGSVF 176 Eggerth...
WP_013251350          91 VALGLLI--GGGVSELVRKAV-G-RRRFS---GIAVGYALFeTCWAA-GIFVPMFADQDYYRALMGSN-NIDpSYMESML 161 Olsenel...
jcvi:HMPREF9154_2829 108 VVVTCIV--GGLMCEVILGLG-N--RTSPsllTLVITYVVF-CLSFI-GDFFPLWFLGDQFLGQMLSS-GMSgEYVETIR 179 Pseudop...
Q73MB3                83 YIISCII--GGVLAMLIARIK-G-IENYK---GLTIGYILFcVLASFgGMYVPFLFYAEQTLNAYKE--MFGaEYLETLT 153 Trepone...
WP_004007231          91 GVVLCIA--GWVIAEAVATAG-K-YASTK---TLVAAYTVGcTIQSA-GFTFPMYYSSVEYLTDRKEMlHLSeEMLNQYL 162 Mobilun...
WP_020965768          88 GVLLSVI--GWFIADSVAAYK-K-YENKK---TLIVSYVIGaSLQSA-LFSLPMYISHGQYFIERREIlHLTnETLQQYL 159 Trepone...
Q73R50                88 GVGLSII--GWFIAETLASTM-K-YKDKK---AIILSYVLGsTLQTA-LFTLPMYLSHGEYFVQRKEIlHLTdEALQQYL 159 Trepone...
jgi:Elen_3089        190 KYYgNAEWIVFIVALTAFAGFLGALVGKRLMRKHFL 225 Eggerthella lenta DSM 2243
jcvi:HMPREF9154_2835 172 DML-NPATMAMYCLLAIVACVAGCFWGRALTRRQFS 206 Pseudopropionibacterium propionicum F0230a
WP_014262050         160 ELV-TPLSLAGLCLLSAFCGIIGAYIGKILLKKHFE 194 Filifactor alocis
WP_009305896         177 DIV-AGPLFFVCLGVTALGGVLGSLLGRAVLKKHFE 211 Eggerthella
WP_013251350         162 SFV-TPQTFAAIAAVTIVGALIGAFLGRAVFKKHFE 196 Olsenella uli
jcvi:HMPREF9154_2829 180 SFI-NGPAIAVIVISIIVGALVGAFFGHRLMRKHFS 214 Pseudopropionibacterium propionicum F0230a
Q73MB3               154 KLV-SPTITVIMLIITALCGCIGALISKKLLKKHFE 188 Treponema denticola
WP_004007231         163 NLF-SWPLYGAMVALTTITALIGSLFALRLLKKHFV 197 Mobiluncus curtisii
WP_020965768         160 NLI-SWYMYGSMIILTVFTSFAGAVISIKILKKHFE 194 Treponema pedis
Q73R50               160 QVVgSWQMYGSMIALTVITSFAGAWISMRILKKHFE 195 Treponema denticola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap