Conserved Protein Domain Family
PhaP_Bmeg

?
pfam09602: PhaP_Bmeg 
Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg)
This entry describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium. The role of the protein may include amino acid storage.
Statistics
?
PSSM-Id: 370578
View PSSM: pfam09602
Aligned: 4 rows
Threshold Bit Score: 158.184
Threshold Setting Gi: 47501740
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
IGS:BMQ_1226     1 MSTVKYDtVIDAMWEQWTKGLQNIAEGNKQIEQWTLKALEQQQEFV---TKAVEQLQATDKQWKAELEDLQQKTVENLrk 77  Bacillus mega...
tigr:GBAA_1327   1 METKPYE-LVDAFWKNWSQSLSLFSSAGKQLEQLTLETLKQQQDALhklTSGVDELEKELQQFTAQFNNQYTDYVKQL-- 77  Bacillus anth...
WP_015593969    10 VVN-----VMDVFWDGWFNSFKTFHSLQNGVEEQSLQVIETQKDWIkstGEQLSRLEEDTKKLTSDWLGNLQSTLNKAqs 84  Bacillus sp. ...
WP_015592219    23 aETNATElFVETVWDQYEESLERSNQFSEDREDAYLKSLKEVIKLNqefRKSLSSIYRESKETNSEI----VKGVSNFas 98  Bacillus sp. ...
IGS:BMQ_1226    78 tAGNAVADSYEEWTNRTHEALNKLQELSLNQSKSSYSLVKQAQEQYHQVVTQLVEEQKKTRQEFQHVSDAYVEQVKSLQK 157 Bacillus mega...
tigr:GBAA_1327  78 -TGNSLNDQINEWQEKWKELSAHMHQLTVSPTKTSLSILTQTSGQFEETTKQFIEQQQLQREEAQKQLEGFLEEFKLKQL 156 Bacillus anth...
WP_015593969    85 eFGGQ---NILEWTDKLEEIGFKSDISDFSPSKAFTDMLSKSHSHLEETLKSAFDQQQKNRTEILKALEVYVDQLKQSQN 161 Bacillus sp. ...
WP_015592219    99 kNGVKDELNFSELTDQLNDVSTRFEKIALTPIKSTFDLLDRFEKGIEENSESFIQYSRERRGGWQKVTNEYAKLARDSQK 178 Bacillus sp. ...
IGS:BMQ_1226   158 SFAQSLEQ 165 Bacillus megaterium QM B1551
tigr:GBAA_1327 157 ELAKKFEE 164 Bacillus anthracis str. 'Ames Ancestor'
WP_015593969   162 GVMKTFEl 169 Bacillus sp. 1NLA3E
WP_015592219   179 NLLNRFEE 186 Bacillus sp. 1NLA3E
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap