Conserved Protein Domain Family
Env-gp36

?
pfam09590: Env-gp36 
Lentivirus surface glycoprotein
This protein is found in feline immunodeficiency retrovirus. It represents the surface glycoprotein which is found in the polyprotein C-terminal to the Env protein.
Statistics
?
PSSM-Id: 150302
View PSSM: pfam09590
Aligned: 5 rows
Threshold Bit Score: 906.989
Threshold Setting Gi: 82281565
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q66975   5 FAANRQWIGPEEAEELLDFDIATQMSEEGPLNPGVNPFRVPGITEKEKQNYCNILQPKLQDLRDEIQEVKLEEGNAGKFR 84  Feline immunodeficien...
Q66956   5 FSQNRQWIGPEEAEELLDFDIATQINEEGPLNPGVNPFRVPGITDTEKQDYCKILQPKLQELREEINEVKLDEDNAGKFR 84  Feline immunodeficien...
Q8UNJ5   6 FAQNQQWIGPEEAEELLDFDIAVQMNEEGPLNPGVNPFRVPGITPQEKDNYCTILQPRLQELKREIKEVKIEEENAGKFR 85  Feline immunodeficien...
P89688  29 FGMNPDWIGPYEGEMLLDFDILQYVTEEGPFRPGHNPFRAPGITEQERQELCVMLQDKLKEIKGTITEGP-HKIPPGKYR 107 Feline immunodeficien...
Q6J4Y9   5 FCQNRQWIGPEEAEELLDFDIATQVSEEGPLNPGINPFRQPGLTDGEKEEYCKILQPRLQALREEYKEGSLNSECAGKYR 84  Feline immunodeficien...
Q66975  85 RTRFLRYSDEHVLSLVHAFI-GYCIYLGNRNKLGSLRHDIDIEAP-QEEYYNNREKGTTDNIKYGRRCCLGTVTLYLILF 162 Feline immunodeficien...
Q66956  85 RVRYLRYADETVLSLIYALV-GYLRYLGNRNKLGSLRHDIDIEVS-AKEQFDKKEKGTTINQKYCTRCCVGISVLYLILF 162 Feline immunodeficien...
Q8UNJ5  86 RARFLRYSDENVLSIVYLLT-GYLRYLIDRKSLGSLRHDIDIEVP-QNEQYSNNEKGNTVNRKYGRICCISTLFLYLLLF 163 Feline immunodeficien...
P89688 108 RLRYLQYSDMQVTQSLALLVfDISHYL--RNKLGKEVYDIEGDRQ-AEYKFEKRVKGRTYNNCRCRLLLIGAGFFYTCLI 184 Feline immunodeficien...
Q6J4Y9  85 RVRYLRYSDLQVFSILYLFT-GYIVYFLRRGGLGKQRQDIDIESKgTGEKFSKNEKGQTVNIRNCKILTIAICSLYIFLF 163 Feline immunodeficien...
Q66975 163 IGVIVYSQTaGAQVVWRLPPLVVPVEESEIIFWDCWA--PDEPACQDFLGAMIHLKAKTNISIREGPTLGNWAREIWATL 240 Feline immunodeficien...
Q66956 163 IIIVAVTGS-QAQVVWRHPPLVVPVEETEIIFWDCWA--PEEPACQDFLGTMVQLKASINIGIQEGPTLGHWAREIWSTL 239 Feline immunodeficien...
Q8UNJ5 164 AGIGVWYGT-TAQVVWRLPPLVVPIDDTEIIFWDCWA--PEEPACQDFLGAMIHLKANINISIQEGPTLGNWAREIWSTL 240 Feline immunodeficien...
P89688 185 IGLGCLIREtSGVILALDPPWVIPVTKMDEINFQCHGnyEECPVLESVATWKTDFQWNYSRPFNETIGLEQYVDQIQAKA 264 Feline immunodeficien...
Q6J4Y9 164 IGIGIYAGQgKAQVIWRLPPLVVPVEDSEIIFWDCWA--PEEPACQDFLGAMMHLKASTNISIQEGPTLGKWAKEIWATL 241 Feline immunodeficien...
Q66975 241 FKKATRQCRRGRIWKRWNETITGPSGCANNTCYNVSVIVPDYQCYLDRVDTWLQGKINISLCLTGGKMLYNK---VTKQL 317 Feline immunodeficien...
Q66956 240 FKKATRQCRRGRVWRRWNETITGPLGCANNTCYNISVVVPDYQCYVDRVDTWLQGRINISLCLTGGKMLYNK---DTQQL 316 Feline immunodeficien...
Q8UNJ5 241 FKKATRQCRRGGIWRRWNKTITGPLGCANNTCYNISVVIPDYQCYVDRVDTWLQGKVNISLCLTGGKMLFNK---ETKQL 317 Feline immunodeficien...
P89688 265 LQDLLGSCQK---------------------LSKNKLGVLQWRCFYDRGMKQLLGLQKIRICPIGGYMLVRKideNNYTL 323 Feline immunodeficien...
Q6J4Y9 242 FKKATRQCRRGKVWRKWNETITGPKGCANNTCYNVTVIIPDYQCYLDRVDTWLQGKVNISLCLTGGKMLYNK---ETKQL 318 Feline immunodeficien...
Q66975 318 SYCTDPLQIPLINYTFGPNQTCMWNTSQIQDPEIPKCGWWNQMAYY----NRCKWEEAKVKFHC--------QRTQSQPG 385 Feline immunodeficien...
Q66956 317 SYCTEPLQIPLINYTFGPNQTCMWNTSLIEDSEIPKCGWWNQAAYY----NSCKWEQTDVKFQC--------LRTQSQPG 384 Feline immunodeficien...
Q8UNJ5 318 SYCTDPLQIPLINYTFGPNQTCEWNTSLIKDPEIPKCGWWNQNAYY----NSCKWEQTDVKFQC--------QRIQSQPG 385 Feline immunodeficien...
P89688 324 SMCTEEIDIKILNMTLSQEKYEHYPFNDIV---------WMGNRYFnmttANITQQQVNISIKCdiivptvvKVKKEFAG 394 Feline immunodeficien...
Q6J4Y9 319 SYCTDPLQIPLINYTFGPNQTCMWNTSLIKNPDIPKCGWWNQAAYY----NSCRWEKADVQFQC--------QRTQSQPG 386 Feline immunodeficien...
Q66975 386 SWRRAISSW---KQRNRWEWRPDLES-EKVKISLQCNSKKNLTFAMRSSGDYGEVTGAWIEFGCHRNKSKHHSEARFRIR 461 Feline immunodeficien...
Q66956 385 NWLRTISSW---KQSNRWIWRPDFES-DKVKISLQCNSTKNLTFAMRSSGDYGEITGAWIEFGCYRNKSKSHGEARFRIR 460 Feline immunodeficien...
Q8UNJ5 386 SWIRAISSW---RQRNRWEWRPDFES-EKVKISLQCNSTRNLTFAMRSSSDYYDVQGAWIEFGCYRNKSIRHTGTRFRIR 461 Feline immunodeficien...
P89688 395 YNNDFLGPWgglKYRSILIRYKDWANvTDPPLDLNCTGLPGIALN-GTEANYTCAQNATITYG------DICTQPELYVP 467 Feline immunodeficien...
Q6J4Y9 387 TWLRKISSW---KQKNRWEWRPDFES-ERVKISLQCNSTKNLTFAMRSSSDYSDVVGAWIEFGCHRNKSRTHAAARFRIR 462 Feline immunodeficien...
Q66975 462 CRWNVGSNTSLIDTCGNTQDVSGANPVDCTMYSNKMYNCSLQNGFTMKVDDLIVHFSMTKAVKMY------------NIA 529 Feline immunodeficien...
Q66956 461 CRWNEGTNTSLIDTCGSTPNVKGANPVDCTMKANTMYNCSLQNGFTMKIEDLIVHFNMTKAVEMY------------NIA 528 Feline immunodeficien...
Q8UNJ5 462 CRWNEGKNMSLIDTCGTDPNVTRANPVNCTLKTNTMYNCTLQDGFTMKIEDLIVHFNMSKAVEMY------------NIA 529 Feline immunodeficien...
P89688 468 C-YSPNYSMPVMVQCKLHQEYHPNDTYRNSSNDMQVMRCRIMKEVELRFGDEFISLNFTLLRDPFlahlrgainftcNLT 546 Feline immunodeficien...
Q6J4Y9 463 CKWNVGSNTSLIDTCGKDQNVTGANPVDCTMTAKTLYNCSLQEGFTMKIEDLIMHFNMTKAVEMY------------EIA 530 Feline immunodeficien...
Q66975 530 GNWSCTSDLPSSWGYMNCNCTNSSSS--YSGTKMACPSNRGILRNWYNPVAGLRQSLEQYQVVKQPDY 595 Feline immunodeficiency virus
Q66956 529 GNWSCNSDIPPGWGYMNCNCTNSTSSsfPTCPKMACPRERGILRNWYNPIAGLRHALQKYQVVKQPAY 596 Feline immunodeficiency virus
Q8UNJ5 530 GNWSCTSDLPTGWGYMKCNCTSTNNT-----GKMKCPEPEGILRNWYNPVAGLRQALMKYQVVKQPEY 592 Feline immunodeficiency virus
P89688 547 GQFWAYKFNNATWGYEGNGSAWNESL--NWLVPYRNYTKEMYVWGAYSAINYNHILLKDYKLVKKPLY 612 Feline immunodeficiency virus
Q6J4Y9 531 GNWSCKSDLPTDWGYMKCNCTSRNET-----DKMKCPAKDGILRNWYNPVAGLRQALDKYQVVKQPDY 593 Feline immunodeficiency virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap