Conserved Protein Domain Family
Phageshock_PspD

?
pfam09584: Phageshock_PspD 
Phage shock protein PspD (Phageshock_PspD)
Members of this family are phage shock protein PspD, found in a minority of bacteria that carry the defining genes of the phage shock regulon (pspA, pspB, pspC, and pspF). It is found in Escherichia coli, Yersinia pestis, and closely related species, where it is part of the phage shock operon. It is known to be expressed but its function is unknown.
Statistics
?
PSSM-Id: 401501
View PSSM: pfam09584
Aligned: 4 rows
Threshold Bit Score: 84.1234
Threshold Setting Gi: 488373767
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002443152 12 KLQSGIKLAGKLVLLTALRYGPAGVAGWAVKSVARRPLKWALAVALEPALRRVAQRIARRF 72  Shimwellia blattae
WP_002901915 11 QVKPGLKIVGKLALLTALRYGPAGVAGWAVKSVARRPLKMLLAVALEPLLSRLANRVTRGM 71  Enterobacteriaceae
Q7CQG9       11 KVKPGFKIAGKLVLLTALRYGPAGVAGWAVKSVARRPLKMLLAFALEPVLRKAANKISQRY 71  Salmonella enterica subsp. enterica...
CAX59835     11 nAAPAFKRVGKFVLISALTYGPGGLAGWAVKSVAHRPLKIFLAWALEPLLRRAVRGASARW 71  Erwinia billingiae Eb661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap