Conserved Protein Domain Family
RE_TaqI

?
pfam09573: RE_TaqI 
TaqI restriction endonuclease
This family includes the TaqI (recognizes and cleaves T^CGA) restriction endonuclease.
Statistics
?
PSSM-Id: 401494
View PSSM: pfam09573
Aligned: 3 rows
Threshold Bit Score: 337.28
Threshold Setting Gi: 62297291
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:THEYE_A0515   8 LQRFRDFLSSIPLDKYREELKNIKWVEQDLPKEILPLSSIFRYYW----EERNFLNFEEWFENFWQHINNNQESKRALED 83  Thermodesul...
WP_015424102       9 FKRYRDFLVTIPLDKYREELKEIKWVEQDLPKEILPLASIFKYYW----EERQFLDFEEWFDTFWKEINTNSPSKEVLNQ 84  Candidatus ...
P29748            10 LEAFEDFLKCLDLESYQEKYRPIKTVEQDLPRELNPLPDLYDHYWkpngNTLHFPDFETFFDQWWEK------RLRPLNE 83  Thermus the...
tigr:THEYE_A0515  84 FKKYYFNRDlgENDWFKKGFKARMYRTWVSVLTQLDFCYLFEYICDKESKNLKLECNSELDRKGIDARVNE----INFQI 159 Thermodesul...
WP_015424102      85 FKKYYFDKD--NNGWFKKGFRARMYRTWVSVLTQMDFCYLFQFLCAREGKILSLECNAALDARGVDAKVGN----IGFQV 158 Candidatus ...
P29748            84 FIRKYFWGC--SYEFVRLGLEARLYRTAVSIWTQFHFCYRWNASCQL-----RLTATWELDAQGIDAQIQAedrlIGIQI 156 Thermus the...
tigr:THEYE_A0515 160 AKITQRKEARSASK------KKSLITIPYAVFNLEDFERKIGSKRVKDKT--GYQNSLEAFKKYFIRLNNGFVVFHENYL 231 Thermodesul...
WP_015424102     159 AKISNRKEARSASK------KKTLVTIPYAVFNIEEFEKKIKSPRVKDKK--GYQNSLKAFQKYFIRLKNGFVVFGEAYL 230 Candidatus ...
P29748           157 KKETYRSEAREGNRflrrreHSALLEVPYTLQSPEELERKAQRARTREEAyrLWVK----IAHHLERLPNGFVIFRESYV 232 Thermus the...
tigr:THEYE_A0515 232 RTIIENI 238 Thermodesulfovibrio yellowstonii DSM 11347
WP_015424102     231 LPIIDNI 237 Candidatus Cloacimonas acidaminovorans
P29748           233 KDLENFL 239 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap