Conserved Protein Domain Family
RE_ScaI

?
pfam09569: RE_ScaI 
ScaI restriction endonuclease
This family includes the ScaI (recognizes and cleaves AGT^ACT) restriction endonuclease.
Statistics
?
PSSM-Id: 401492
View PSSM: pfam09569
Aligned: 3 rows
Threshold Bit Score: 314.58
Threshold Setting Gi: 658298642
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_062686915   3 SPYDNLPMEQWINVTEELVGNHPLNNDDIVSIVLEAWDRILDTKIgGELQIGVDVFP---GPQIMGNYLHELIPALLSRK 79  unclassified Ba...
KEI67037       3 SPYEGLSIEQWKSKTQELIENHPLHLEMIREIALKSWDILWQTTI-GEGELAIPLYSldvPAMVVGYFFEKLFAKELQKR 81  Planktothrix ag...
WP_013546469   3 SPYNGLNVEDWKSKTEELIKAHPLK-EKIVPIVLKAWDDIFNSQM-GSFKIGKDIFP---SPQIMSFFLHELVAHYLSLE 77  Bacteroidales
WP_062686915  80 FPQYWRKEIIKEDKDVVYIPNNDYSVEIKTSSNPN-NVYGNRSYGQENSENN-SGKSKSGYYITVNFEkfdvenpanKPE 157 unclassified Ba...
KEI67037      82 EPQLWRGGVSKEEKDLVYISDQLYSIEIKTSGQLGlKIFGNRSYGKSVENPDlAKKEKSGYYITVNFY---------DRI 152 Planktothrix ag...
WP_013546469  78 YPKEYKVGEAKKEKDVHNIINPQMGIEIKASSHPT-QIFANRSYAQPSSSSE--EKDKNGYYIGINFEkfse--snpKPQ 152 Bacteroidales
WP_062686915 158 IKKIRFGWIDHTDWKAQKSQTGQAAPISKEARDNKLVLIY 197 unclassified Bacillus
KEI67037     153 INLIRFGWIDHSDWKAQSSESGQSAGLSEEIYTYKLIPIA 192 Planktothrix agardhii NIVA-CYA 126/8
WP_013546469 153 ILQIRFGYLEHSDWIAQKAATGQQARLSTNADKNKLITIY 192 Bacteroidales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap