Conserved Protein Domain Family
RE_SacI

?
pfam09566: RE_SacI 
SacI restriction endonuclease
This family includes the SacI (recognizes and cleaves GAGCT^C) restriction endonuclease.
Statistics
?
PSSM-Id: 401489
View PSSM: pfam09566
Aligned: 7 rows
Threshold Bit Score: 305.209
Threshold Setting Gi: 504660505
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014128552     3 M---REEAEKILKKAYAVASYNPESTCTH----EEli--dyVIDNTHl----------TYKYVLFTALLSKATDEKINPL 63  Acidaminococc...
jgi:Halhy_3075   3 EniiRAEAEKVLLAAFRTRCSKKDYISSN----IVa-----VLRGNHk----------TYKYILVNGLLAKATNENINPL 63  Haliscomenoba...
WP_014128552     3 M---REEAEKILKKAYAVASYNPESTCTH----EEli--dyVIDNTHl----------TYKYVLFTALLSKATDEKINPL 63  Acidaminococc...
CDC36792         6 N------ASDKLNAAYIDAQRTINPTCEHkdfiDF------VIDNTHl----------TYKYVLFTAILAKAADESINTL 63  Butyrivibrio ...
WP_015190381     6 PtvdQTAAKQLFQEAIAIAQDESRKTPAT----GWdieirtIIEGKHl----------TFRYILVTALLAKATNQKINAL 71  Gloeocapsa sp...
WP_014847607     8 T-----VAAERLNRAYATASA---GIHDH----HW------TQRIDEvwaf----askTYVPALGTILLAKTVDDRVDVG 65  Pseudopropion...
Q3A7G6           3 itinHSDACKILHEEFERTSSEPEDDLEA----QW------RIRVKRlselcpyrksaTFIAALGTAILAKSVNSKVDVF 72  Pelobacter ca...
WP_014128552    64 CLQKKST-LP-GAYDARTICHKVIVP--FEMEVLKKAMGGSN-EPFLNKP-ARFPELSK----TNA-VRRGNDQnILNAL 132 Acidaminococc...
jgi:Halhy_3075  64 ALQAGAS-IE-GAYDARSLCHNVLVP--FERDFLQNALGGSN-EPFLNKP-ARFTHLSD----RNA-VRRGRDK-ETLEL 131 Haliscomenoba...
WP_014128552    64 CLQKKST-LP-GAYDARTICHKVIVP--FEMEVLKKAMGGSN-EPFLNKP-ARFPELSK----TNA-VRRGNDQnILNAL 132 Acidaminococc...
CDC36792        64 CLQKKSE-LP-GAYDARTICHKVIVP--FEMEVLDKALGGSN-EPFLNKP-ARFPELSK----TNA-VRRGNDQtILNSL 132 Butyrivibrio ...
WP_015190381    72 ALQAGAD-VE-GAYDARSLCHRVVVP--LERKLLNRSLGGSN-EPFLNKP-ARFPTISP----SNA-VRAGRDReLLLIL 140 Gloeocapsa sp...
WP_014847607    66 TIKVLPDdVNpRTFSLRTLCHSVLVPgsKRLQFSIRSTG--R-EPLNNQPwFRFSHVDEinrvRDP---RDLER-YRQIL 138 Pseudopropion...
Q3A7G6          73 CILERDG-GD-TSYSARSLADKVWAK---ERAYLEINLGANRaNPLNNVPfIGRARIDGienvRNKeGYEYLCE-CLNAL 146 Pelobacter ca...
WP_014128552   133 C--DNLPTIKTSqDAFDCLVYLLCKLIKLRD--------------------------------AQKkSLN-----FYV-R 172 Acidaminococc...
jgi:Halhy_3075 132 Vi-KIFESIPTSiEANHYLTCALEFLAQKIEenkilhdskinynptlveiyefifrflekpyeGETlAIVv----AAI-E 205 Haliscomenoba...
WP_014128552   133 C--DNLPTIKTSqDAFDCLVYLLCKLIKLRD--------------------------------AQKkSLN-----FYV-R 172 Acidaminococc...
CDC36792       133 C--DNLPLITTStDAYECLIYLLSKLINIKNa-------------------------------KST-MITftiekNAN-L 177 Butyrivibrio ...
WP_015190381   141 HnvLSEIKTSEQ--AFNSLCVALKYAIKRQIar----------------------------fePS--QLA-----DSAdS 183 Gloeocapsa sp...
WP_014847607   139 QeiDRLDRVGAQ-LALTSYVFV---GIRem--------------------------------gKRQ-LIA-----QVA-G 175 Pseudopropion...
Q3A7G6         147 SeiKQEVLARTV---LRAFIASQKETDVRTFev-----------------------------gKEA---G-----DYL-V 185 Pelobacter ca...
WP_014128552   173 ETSNTpALLWTYI-IKALKEsfeGeilTLMVAGtyh--liyK----DrpgarVEvhpvnqsgasgrevsDLDIY---VDN 242 Acidaminococc...
jgi:Halhy_3075 206 KIYYQ-KLTQNYK-VVAHKV---N---QSGASS--------K----E-----VG---------------DIDVY---KDD 242 Haliscomenoba...
WP_014128552   173 ETSNTpALLWTYI-IKALKEsfeGeilTLMVAGtyh--liyK----DrpgarVEvhpvnqsgasgrevsDLDIY---VDN 242 Acidaminococc...
CDC36792       178 PTHLM-AYMEKAL-EHSYE----GeilTLLVAGtyh--lmyN----Epn-atVEvhpvnqsgasgreisDLDIY---VDG 241 Butyrivibrio ...
WP_015190381   184 HLKII-EFVTAFA-TRSIEG---Qv--AAIVTGtilstyfdQfegfE-----IIvhpinqsgassnevaDIDIK---KNG 248 Gloeocapsa sp...
WP_014847607   176 SLSVD-AILDGVAeLMQYGG---PfvvQALGAVfvs--qfaP----Q-----IAtrrlndp--srdfpgDVQALd--DQG 236 Pseudopropion...
Q3A7G6         186 IQSLS-EIIDRFV-CIDSED---GrraQASAAGllvt-afgK----En----IEvghvndp--drnfplDIGVYnsaEEG 249 Pelobacter ca...
WP_014128552   243 ELISSNELKDKNFSEPDVRHAADKVITAGGNHMLFIFGP 281 Acidaminococcus intestini
jgi:Halhy_3075 243 NFYYAIEVKDKNFTSYDLEHAFKKIQDAGGMKGQFIFGP 281 Haliscomenobacter hydrossis DSM 1100
WP_014128552   243 ELISSNELKDKNFSEPDVRHAADKVITAGGNHMLFIFGP 281 Acidaminococcus intestini
CDC36792       242 SLVASNELKDKDYAETDVRHAADKVLSAGGTKMLFIEGP 280 Butyrivibrio sp. CAG:318
WP_015190381   249 RIFVAVEVKDKQFGQQDVDHAAFKASQYGLKSITFVIGV 287 Gloeocapsa sp. PCC 7428
WP_014847607   237 RPFLSLEARNKRVSMSDALAFAGACAAHGISRGIILELT 275 Pseudopropionibacterium propionicum
Q3A7G6         250 SFHSAIEVKDKKIEGSDLLASIDKACEMKIFNVLYLAIA 288 Pelobacter carbinolicus DSM 2380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap