Conserved Protein Domain Family
RE_LlaJI

?
pfam09563: RE_LlaJI 
LlaJI restriction endonuclease
This family includes the LlaJI (recognizes GACGC) restriction endonucleases.
Statistics
?
PSSM-Id: 370562
View PSSM: pfam09563
Aligned: 3 rows
Threshold Bit Score: 510.199
Threshold Setting Gi: 500063686
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O34303        48 YVGVISNGRNVIFILPKYCNRHLDEHSKR-----TLFNKLLKIFKKYSGLNKSRE-SDYFVSELDSDEVSDFMIADYLLN 121 Bacillus subtil...
Q81H81        51 FVGLIVYKNKYLFVFPKYIDYATEDEILS-----KKMKLICQLLNKYGIFNSTYDnTDFLINNIEDKFISTFAISRFLLE 125 Bacillus cereus...
WP_011743603  43 FVGIVAFADCVIFCFPKKLFASPS--NISdedteQLISLVTKSLIRFRDDYPHSPeDAGFLYSADRRTSTPLLTAMELIQ 120 Bifidobacterium...
O34303       122 DFSLNGYYQKKFTEYEIDGEGIIDWSKTVNEITPVFSKGVPYYFSTYNEVVQKDEYHLIVKIHKWALSKYFNDFGVILGF 201 Bacillus subtil...
Q81H81       126 DYLRNGYYSKKITDVGINEDGEIIWEKTVSEINPYYVKGVPYYLDTFNTRQLDDETNIIIHIHKWAISYCTEAFAYLQGI 205 Bacillus cereus...
WP_011743603 121 DYEVNGPIRRFLTQYSQNQSGRIAWNRTIQRSDPIFTESSVFYPLPVIARRIDDDDSPLTILHKACVQDCYKRWGWLIDP 200 Bifidobacterium...
O34303       202 TGLEFDKSCDGMKILD-YADFFGSVINKEIVNTYVDRDVKLLKALKTAIDREENqfSKRPTLSLYGTKYFHRVWEEVCKT 280 Bacillus subtil...
Q81H81       206 DNLDFERMNVDLAEIG-EVEYLVNVLERELQITFLDEKMILLKALIALIKKRTH--SKLTELDIYGTREFEYIWEKVCGY 282 Bacillus cereus...
WP_011743603 201 ERYHVNFRQHERGWLPcTQETALTFLSREKWTVFSDREMHVIDLLMQYISSTIRndSKND-VSFFGTKTYWRVWEATCKH 279 Bifidobacterium...
O34303       281 VF-SHVNEYVKKISRPNWINFTdIEVNKEKKTLEPDIIKAFeYRSKEYFLILDAKYYNINFDGKKLEGNPGVEDITKQLL 359 Bacillus subtil...
Q81H81       283 VFdNEISQYENFLEKPKWTDFN-AMQLITKKTFRPDIIKTY-IDIQRYFLILDAKYYNIRFKEGDLKGNPGVNDIAKQLL 360 Bacillus cereus...
WP_011743603 280 IFhDDQYIYDNLLPQPRWK----LPNLKPDTSQRPDVLFVT----NDTLYILDAKYYDY------RHNMPGGPDIIKQYY 345 Bifidobacterium...
O34303       360 YDKALEKLS-------RGKTKH---NAFLFPSSnSTNTFKVFGSVDFDFL------------DIAAVTLVYISAE 412 Bacillus subtilis su...
Q81H81       361 YEQALSAYT-------KGSITR---NMFLFPYD-KDELFDVFGNANLDFM------------KMDPVILVFLSAD 412 Bacillus cereus ATCC...
WP_011743603 346 YEDTLRSVLckrkgndKYSRIKgttNAFIFPEApKNE-----DTVKFHFIadayierlpdwrAIP---AFALDIK 412 Bifidobacterium adol...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap