Conserved Protein Domain Family
RE_LlaMI

?
pfam09562: RE_LlaMI 
LlaMI restriction endonuclease
This family includes the LlaMI (recognizes and cleaves CC^NGG) restriction endonuclease.
Statistics
?
PSSM-Id: 401486
View PSSM: pfam09562
Aligned: 3 rows
Threshold Bit Score: 334.989
Threshold Setting Gi: 740776749
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009627863  16 VRGRKPDTSN-INQDHDGKAGHWLEHQMGIKINNKTEADLFGYEMKNQTTSGKITFGDWSADYYIFKDYKYFTS--GNTG 92  Pseudanabaena b...
WP_015225502   1 MRGLKATTTN-INQKHDGAKGHWLETQMGISHNNTNKADLLGYEMKTGTSSGKISFGDWAADYYIFDNEDFFDV--SETR 77  Halothece sp. P...
WP_038562033  28 F-----DIDNrINK-------HWLEQKFGLNYNGECICSDVGYELKIE-SEKMINFGDWTPNYYIYNQTDYLEIfpGNTP 94  Mycoplasma cali...
WP_009627863  93 V-NRDCFMQIF-GTYKLDKGRYSWSGEVTPKIKNF-NRYGQKLIITENKDITAIYSYDQDSRQNKKdiIPVNMQINDLIL 169 Pseudanabaena b...
WP_015225502  78 IvRRDQFIKVF-GKFNQTKNRYSWSGEVCPTYYNRrTNSGQMINISPTNDVLIEYNHSEDFRNDNE--IPSYFQKDNLIL 154 Halothece sp. P...
WP_038562033  95 AeRRVSFLLMFaGDFDRN-NRYYWNGENCIQTKCS-NYCGLILRVEDNSDISIIYNFSEDKRINKYevVDFRLQKENVIL 172 Mycoplasma cali...
WP_009627863 170 ARW--------------TSNSMKKRVESKFNDKGWFKCLQNSLGVYTNIQFGKPITFESWIDLVAEGVVFFDSGMYQG-- 233 Pseudanabaena b...
WP_015225502 155 AKW--------------DAKSLRKKVEKKFNQKGWFKCFINEEGQYTSIGFGNPITFEIWIKLLKEGKIFFDSGMYADpn 220 Halothece sp. P...
WP_038562033 173 AQWfgrkntkvkrngifNGRSLQSRFEDKYEGKGFCVVKSDHQGYYRSIKFGYKLTFRDWVQQVEEGNVIYSCEMNAE-- 250 Mycoplasma cali...
WP_009627863 234 --NNRPYSQWRALNNF-WDSLIIETY 256 Pseudanabaena biceps
WP_015225502 221 kpNQRFYSQWRAITKV-WDDLIKETY 245 Halothece sp. PCC 7418
WP_038562033 251 --NHRTYARWESANNIyWDRV--ANI 272 Mycoplasma californicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap