Conserved Protein Domain Family
RE_HaeII

?
pfam09554: RE_HaeII 
HaeII restriction endonuclease
This family includes the HaeII (recognizes and cleaves RGCGC^Y) restriction endonuclease.
Statistics
?
PSSM-Id: 370557
View PSSM: pfam09554
Aligned: 3 rows
Threshold Bit Score: 599.576
Threshold Setting Gi: 504980097
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015158244   6 AKAALDRIIKISRVHLYKPIQIAEILYRDRVHRDLDLSDLNTYRNTSKAWRNLITDRFVGRSSSSSAEYQEALFTK-AMP 84  Chamaesiphon mi...
WP_015167199   7 AKERLDSIVRKARVDMYKPIQIAEVLRRSRIQKDIQILKQDTYQNPSIHWRNKVTRRLIGKVSTSSANYQHDIWNQkAMP 86  Synechococcus s...
Q5F5D7         8 AKEALDGIIKKSRVHLYKPIQIAEILYHDRCIKQLDFLNLDTYRNQSKRWRDEICRRFLGRISTSSAKFQDNLFEKnAIP 87  Neisseria gonor...
WP_015158244  85 PQTLVILGEENRLKGGIIEAYIYRRFAERFTQLSSALNYYDTHSTTDFEVREFIDLFWSEPGLRRSIDKVYEIVVYSLFS 164 Chamaesiphon mi...
WP_015167199  87 PDLLAVLDHENKRTNGGVEYYIYLRFSERQNTVASVITFIETSLPENFDLSELLIKFTSQSEIRRSVDKAYEIVVYSLFE 166 Synechococcus s...
Q5F5D7        88 PEKLAVLGTLNRQSDGGVESYIYKQFFNRFSQMSEALAYVGNTDRYSFQLSEFLNLFWLEPGLKRSIDKIYEIVVYALFD 167 Neisseria gonor...
WP_015158244 165 VLVEALEVTITISINESKLGLLEEFSDFTEMVIGLTQDKYLLNLPAKIYRVGVTNAADRGLDMYANFGMAIQIKHLSLTP 244 Chamaesiphon mi...
WP_015167199 167 TIVNALETTVKVSIPVKNTNLLAEFSDLTKVLLGLELGSNSWEVPAHIYRVGVTNAADRGLDMWANFGAAIQVKHLTLNQ 246 Synechococcus s...
Q5F5D7       168 ALVSELGITVSIDFPKENLFLWEEYQDFAEKIITMPKNEH-LKLPAKIHRVGVTNAADRGLDMWSNFGLAIQVKHLSLDE 246 Neisseria gonor...
WP_015158244 245 ELAENIVGSVTADRIVIVCRDSEQALIVSLLNQIGWKAKIQSIITENNLQGWYEKALRGSFSAAIGKRILLTLKEQIIAE 324 Chamaesiphon mi...
WP_015167199 247 ERAQSITNQVESDNVVIVCRDADARVIETIANQISWGSRVRGIVKESELIDWYERCLRGKFSKQLSKALLERLVYGFKSE 326 Synechococcus s...
Q5F5D7       247 ELAEDIVSSISADRIVIVCKKAEQSVIVSLLTQIGWKSRIQNIVTEDDLISWYEKALRGQYP--IAEALLENIKTEIMRE 324 Neisseria gonor...
WP_015158244 325 FPAs-dNRDFTEFYESRNY 342 Chamaesiphon minutus
WP_015167199 327 FPQ---ASTISDFLSERNY 342 Synechococcus sp. PCC 7502
Q5F5D7       325 FPAvneANEFLDFAQNRGY 343 Neisseria gonorrhoeae FA 1090
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap