Conserved Protein Domain Family
DUF2385

?
pfam09539: DUF2385 
Protein of unknown function (DUF2385)
Members of this uncharacterized protein family are found in a number of alphaproteobacteria, including root nodule bacteria, Brucella suis, Caulobacter crescentus, and Rhodopseudomonas palustris. Conserved residues include two well-separated cysteines, suggesting a disulfide bond. The function is unknown.
Statistics
?
PSSM-Id: 401474
View PSSM: pfam09539
Aligned: 28 rows
Threshold Bit Score: 82.7096
Threshold Setting Gi: 503066165
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013301141            38 LLVRLAGHFGALHRLDQLCGRgYEDDRFRKRMREIVPLEVPMG-ATRLDMVEAFNTGYRNMSRVYLSCSAEAAAAYESEA 116 Parvu...
jgi:Rvan_3523           83 QLFRLAEILGTLHYLRELCGG-NEGQVWREHMRELVSSEGTSA-LRRAKLVEAFNRGYRDYSRTYRTCTQPALVAIQRFM 160 Rhodo...
WP_013948580            38 RLMRLSEILGAIHYLRELCGA-NEGQYWRDRMHDLMNAEGSTA-LRRAKLTRAFNQGYRSYSRTYNTCSPSAQTAITRFL 115 Hypho...
PRJNA229194:W911_06625  61 QLLRLAEILGAVHYLRELCSA-DDGQLWRDRMKELLDTEGATA-LRKARLTRSFNQGYRSYRRTYATCTPTAQSSIERFL 138 Hypho...
jgi:Plav_0757           32 SMMQLAEVLGAVHHLRTLCGT-NEGPLWRNKMIEMMGVADPSE-TERQQLIQRFNDAYHRYRNSYQTCTSTAAGQADKLM 109 Parvi...
WP_015826987            39 ikrDLAGVLGEVHYIRTLCNG-SKDQYWRNFMSDFLKHEAISQ-QRKSLFTAAFNRGYKFQSQRLSRCDSKVAILEVTLA 116 Hirsc...
Q0BYH4                  40 DAADLAGVLGGAHAIRVLCNG-NEDQYWRRYMADLLTTEAPEPgNLRSSLVSSFNETYSQTADQFRICDGRAVEAEARYA 118 Hypho...
Q0ARH1                  68 TLPYLAYTLGELHYLAFACGG-PDDQQWREQMVELLAMEAADDrRWRDRLIEGFNDGYRAQQRYRTRCGLEADAERRALA 146 Maric...
jgi:Caul_4418           37 QLLDLAFTIGESHALRQLCEG-PNDQYWRSRMVRLTEVEKADQ-AFDAQLRDRFNTGFAAGQGQFPQCDETSRRAQQQSA 114 Caulo...
vbi:Avi_1465            55 QLNRLSEILGTVTYLRNLCAG-QPEQQWRAVAEKLIALDAGTEpVRKQMLTAAYNRGYRAFAAVHPSCTSAARVAESQYR 133 Agrob...
WP_013301141           117 RESLSVVDRL 126 Parvularcula bermudensis
jgi:Rvan_3523          161 DQATTITDGL 170 Rhodomicrobium vannielii ATCC 17100
WP_013948580           116 SEGSELSDGM 125 Hyphomicrobium sp. MC1
PRJNA229194:W911_06625 139 VEGIEIGDGL 148 Hyphomicrobium nitrativorans NL23
jgi:Plav_0757          110 QDGQRLADEL 119 Parvibaculum lavamentivorans DS-1
WP_015826987           117 SKGRRMAESI 126 Hirschia baltica
Q0BYH4                 119 RRGEEIAGRL 128 Hyphomonas neptunium ATCC 15444
Q0ARH1                 147 HRGRDLSEMM 156 Maricaulis maris MCS10
jgi:Caul_4418          115 SKGQALSARL 124 Caulobacter sp. K31
vbi:Avi_1465           134 AEGATLVREM 143 Agrobacterium vitis S4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap