Conserved Protein Domain Family
DUF2378

?
pfam09536: DUF2378 
Protein of unknown function (DUF2378)
This family consists of a set of at least 17 paralogous proteins in Myxococcus xanthus DK 1622 and and 12 in Stigmatella aurantiaca DW4/3-1. Members are about 200 amino acids in length. The function is unknown.
Statistics
?
PSSM-Id: 370550
View PSSM: pfam09536
Aligned: 45 rows
Threshold Bit Score: 138.127
Threshold Setting Gi: 122388619
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q08X17             24 LATPADTARGLFFNGVLSAVitfgGEPALKQCHARLndkrfERRFIDFSSYPVSDFLRLTLAASQMLNSQFgNPETTQRR 103 Stigmatell...
mpitm:STAUR_0133    4 KLVFDYAIEGLFLRGLAGQM----TQRLKDRLRQGGi----DLDQKLLPAYSFDTWVRCLEMAVTELFPAL-PEPDAWRL 74  Stigmatell...
Q1DEI6              4 KLVFEHTLEGLFVRGLGARV----TPVLRERLREVGv----DLERKLQPAYAFETWCFAVRVAARELHPDV-PDDVGYAL 74  Myxococcus...
Q1D5S3             33 RLVFPPIVEGLFVRGLSGRV----TPLLKEQLRSEGl----DLDRPLLPAYSLEAWIRCVTLTAKALHPQE-PDEVAWRM 103 Myxococcus...
MPITM:COCOR_05786   6 KLVFPTIVEGLFVRGLSGKV----PFALKEQLRKEGl----DLDRPLQPAYSLDTWTRCVALTAKTLHPDQ-PDAVAWRM 76  Corallococ...
WP_014398511        5 RVIFSSSVDSLYRKVLAPSL----TPELVDRLRARGm----NLHAPLLAAYPLAVWVDCLADTARTLHPDQ-PVEQGRRL 75  Corallococ...
MPITM:COCOR_00499   6 RQVYVQVVEGLLQHGLKGQI----SPRLRERLRQAGv----DLDRPLLPLYPVPLWARCLEIVIEEVYPGM-PKVEGYAR 76  Corallococ...
Q1DET9             15 RLVYVQVVEGLLEHGLRGSV----SPRLKHRLRQAGi----DLDRPLLPGYPVLLWGKCLDVIVEETLPGL-PREEAFRQ 85  Myxococcus...
MPITM:COCOR_00815   5 RLVFQQSFEGLI-RALGDHL----DEPCARQLRDVGi----DPRGKLAVAYPLEVWVESLKLAASVLAPAA-TLDDGAEV 74  Corallococ...
Q1CW57              6 PLVFQQSFQGLL-RALGDDL----DDACVGRLREAGl----DARGSLALAYPLKVWVAALKVAAATLAPEA-PLDEAAAV 75  Myxococcus...
Q08X17            104 LGMQATRDFLSSMAGRTVLLLS-GDSPKRLLDKIPNAYRSAVSYGERTVTMMGDKAARVVFTRDFMLPHYNEGVLSAVLE 182 Stigmatell...
mpitm:STAUR_0133   75 LGEFMVKGYQETPTGAAMLTLLtALGPHQRLARLQKSLRSGNNYTLTRLKTVAPTVVEVWVNDASSTRYFVQGLIFAGMF 154 Stigmatell...
Q1DEI6             75 LGERLVDGYRETVLGRAAFGVIqLLGPRRCVSRARQMFRSGNNYTETRLDDVSPTEVDLWMNEAGAIRYFTQGALRAGLR 154 Myxococcus...
Q1D5S3            104 LGERMIDGYRDTLMGRALLGVMkLLGPWRMLSKAQHGFRTSNNYTEVRITETGPTEAEVWLNEPGMLRYFKQGVMLAMSR 183 Myxococcus...
MPITM:COCOR_05786  77 LGERMIDGYRDTMVGRALLGVLrLIGPKRMLMRAQHSFRSGNNYTEARITERGEREADMWLNEPGLLRYFKQGVMLATVR 156 Corallococ...
WP_014398511       76 MGRRMVEGYAQTLVGGAVLTLArVVGPMRSLERMQHNFRSGNNYTETRLTVLGPAQADLWFNEPEALEGFVDGVLEEGML 155 Corallococ...
MPITM:COCOR_00499  77 LARAHVEGYGATLLGRAVMGVMrVLGPRRVVQRMPEVLRGTDNYTEVTLVERGPAHFELHFNSSLKGPGYVEALLEALLA 156 Corallococ...
Q1DET9             86 LAERHVQGYGRTVVGRAVYGVMrLLGPRRMVQRLPQTLRATDNYTEVELTEQGPTTYAMRMNSRVDAPGYAEALFESLLR 165 Myxococcus...
MPITM:COCOR_00815  75 VGRRFLEGYGATLIGSALLAGVrLLGPHRMLERMTRNLRTGTNYLEARLEQTGPTRYVLTCRPVVV-AGFYRGLFSAGLE 153 Corallococ...
Q1CW57             76 VGRRFVEGFSSTLIGNALLGTVrLLGPQRMLSRMTRNLRTGTNYLETHIEQLGPTRYELTCRPVVV-AGFYVGLFLAGLE 154 Myxococcus...
Q08X17            183 SVNARNPRVHSRPIGPMDSEYELAWD 208 Stigmatella aurantiaca DW4/3-1
mpitm:STAUR_0133  155 MDRVTGLTVDILGVDAEGTTYRIAWR 180 Stigmatella aurantiaca DW4/3-1
Q1DEI6            155 AVGAPHAEVQVRAFTDEGVTYRLTWR 180 Myxococcus xanthus DK 1622
Q1D5S3            184 AAGGVAASVDVRAFDEHCVTYRVSWK 209 Myxococcus xanthus DK 1622
MPITM:COCOR_05786 157 AASGPATQVDVVQFDDDSVTYRVSWg 182 Corallococcus coralloides DSM 2259
WP_014398511      156 RVGVQGFTLHRTRHSPDSATYHLQWA 181 Corallococcus coralloides
MPITM:COCOR_00499 157 AGGAKAPCVTKLYDDGERTEYALTWi 182 Corallococcus coralloides DSM 2259
Q1DET9            166 LGGAESPRVARIHEDADSTTYQLTWT 191 Myxococcus xanthus DK 1622
MPITM:COCOR_00815 154 MSGAHGASVVLMRAAGDAAVYDLSWl 179 Corallococcus coralloides DSM 2259
Q1CW57            155 ASGAKHPSVQIVRREGEEAVYDIAWS 180 Myxococcus xanthus DK 1622
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap