Conserved Protein Domain Family
RE_HindVP

?
pfam09519: RE_HindVP 
HindVP restriction endonuclease
This family includes the HindVP (recognizes GRCGYC bu the cleavage site is unknown) restriction endonucleases.
Statistics
?
PSSM-Id: 370544
View PSSM: pfam09519
Aligned: 13 rows
Threshold Bit Score: 445.62
Threshold Setting Gi: 389889643
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
kribb:BBB_0113    48 KNNFTTEAPISFLMYIDEVLKKPTVLiegTLNDKkqLSTHQAYVPLAEVFGA-DPC--NVGFRFEESFEGYDKYAT-NKA 123 Bifidobacte...
jgi:PCC7418_3643  29 KNQFNTAFPTALGCYMHQKEIDPIYL---VLNSD--LEVEKKTIKVNSIYGI-NPLanETFYAFENQYNCYQHLVN-NGL 101 Halothece s...
WP_009543215      27 KNQFNSSFPSALTCYMSYKNIQPVYL---TLDHK--LTVKHGKISVSSLFGL-DYSspHLFFAFERDYIPYQDIVI-GNL 99  Crocosphaer...
jgi:Cal6303_4524  30 KNQFNSSFPASLACYMHSIQVQPVYL---KLNSS--LNIIQEQITVTELFGE-VPLseKLFFAFESDYLPYRKIVI-GKL 102 Calothrix s...
jgi:Cri9333_2555  29 KNQFNNSFPTALACYMQSKELEPVYL---TLDQQ--LSINHTKINVSQLFGI-NPSspHLFFAFESDYVPYRKTVI-GKL 101 Crinalium e...
jgi:Anacy_0948    28 KNQFNNSFPASLACYMYQKGMKLNYL---VLDEN--LTIQHQEIDVSEIFGI-PPLspNLFFSFESDYVPYRKIVI-GKL 100 Anabaena cy...
jgi:Syn6312_0093  24 KNCFNSSFPMALCCYMSHMNISPVYI---SIDNK--LNIKHEKESVSQLFGI-PSNssDLFFGFETVYLPYQNFVH-GIY 96  Synechococc...
CDE68160          21 KNCFNSSYPTATAAYMLHNNIPAIYIhlaDVNGQ--LQVVADEIPIKDVFNCgSTQseDLYFSFESIYEPYQQYSF-DTI 97  Clostridium...
WP_009291115      21 KNCFNSSFPTSLACYMLDNDIKAIYItlaVKDNK--LVIEPKEISISEVFNCtNKSlrDLYFSFESIYEPYQQYSF-DAI 97  Anaerostipe...
jcvi:PRU_0665     38 KNQFNSSFPASLVAYMGSKGVNPIYI---CTNKK--NEVVHKTINTTDLFGV-NPLgeDAYYNYEAEYYPYEQFYYaAKK 111 Prevotella ...
CCX40468          25 KNQFNSSFPASLACYLHSKGMKAVYI---KAKPD--MKRDLQYIGIDELYGI-DPLgdDIFFSFETQYTPFQKYVI-GAI 97  Firmicutes ...
BAI88192          29 KNCFNSSFPTALCCYLHDINLENIYI---KVNSN--LEIEHTKIATEDVFGI-NPQsdLAFYAFESPFTPYQQYLI-GTL 101 Arthrospira...
P44999            37 KNQFNSSFPVSLCCYMSSKGILANYL---SIENA---EIKCSSIDIKDVFEI-EPEneNTFFAFETSH------------ 97  Haemophilus...
kribb:BBB_0113   124 NRSDVVVVD--RETGDHKSAFEVKLVVVPNSGTARKSHDDQSCEIVVRPPSIEQLTFSIADTYGKTGmeELRKIIVK--- 198 Bifidobacte...
jgi:PCC7418_3643 102 PRIDLVINRiqNKQLSPLRGIEIKLTALPDHTTFSESDENYGCEIVIRPDTIVYLALSIALKFQEEA--NALKDLIS--- 176 Halothece s...
WP_009543215     100 PRIDLVTIDi-SKNNLCLRGLEIKLTALPDNTTCELSDDKYGSEIVVRPPTIVYLSISIARAYQQDR--KILKDYLN--- 173 Crocosphaer...
jgi:Cal6303_4524 103 PRVDLVTQDikTNKDSCLKSLEIKLTALPDNSTYRLSDDRYGCEIVVRPDTIVYLALSIADKLQHNK--ETILEYLD--- 177 Calothrix s...
jgi:Cri9333_2555 102 PRVDLVTQDt-SQSDSCLRGLEIKLTALPDSSTCNLTHEQYGCEIVTRPDTIVYLALSIANNFQQSQ--QELLNYLD--- 175 Crinalium e...
jgi:Anacy_0948   101 PRVDLVTHDi-NRDNACLRSIEIKLTALPDNSTYRLPDNQYGCEIVTRPDTIIYLALSIAHEFENSR--DKLLNYLQ--- 174 Anabaena cy...
jgi:Syn6312_0093  97 YSADVVLSN--KITRHQFRCFEIKLTALPDNTTCSLSDSEFSCEIVVRPSTIAFVALGIVNHISNTGlvQIFSRLLS--- 171 Synechococc...
CDE68160          98 DGIDLVVKDl---SGNFLSPLEVKLTVLPTDSTCKQPEEKWGCELVIRSATTSYCALGMFDSVKNKS--QHIREIFE--- 169 Clostridium...
WP_009291115      98 DGIDLVVKDi---NGNYLSPLEVKLTVIPTSQTSTLSEEKWGSEIVVRSATTSYCALGMFDSIKESA--QDVREIFE--- 169 Anaerostipe...
jcvi:PRU_0665    112 EKIDLVMIN--RSTEVAASGLEVKLTTLPDNTTKDLEESEYGSEIVVRSPTILFLACSICSCYNSEKgkNRLHSILN--- 186 Prevotella ...
CCX40468          98 PRDDLVI----LSDGQCVSSIEIKLVALPDNPTCNLSEDKFGSEIVVRPDTIIYLACSFIQSYEDNP--EALRNVIR--- 168 Firmicutes ...
BAI88192         102 PRVDLVT----QTNGLCLRPMEIKLTALPDNTTCELPENEYGCEIVVRPDTIVYLACSIASTLRQQG--TNIAELLKltf 175 Arthrospira...
P44999            98 ---------------------SIKLTALPDHTTCDLTDADFGSEIVIRPDSIVYLACSLA---------EILKESLAncm 147 Haemophilus...
kribb:BBB_0113   199 FLGDSIqyFKWEDESFMLRRLPQIREAAEAIAK------AKLAQQKPFAITGLWRTQGQRGLLDENCFDSFVWTNLAFLQ 272 Bifidobacte...
jgi:PCC7418_3643 177 PHLEDIreNNWYDPDVMRQNSDKIISAIDAVLL------SRLSQQEPFLLQPIWKTEGKTLILHENCLDIFVWSDYALTR 250 Halothece s...
WP_009543215     174 PICNFI--TDWTSPSCILPIIDEIISVIDVVIS------SCLDSQIPLIMQPIWKTEGKSAQLHDNCLDIFMWSNLAFTR 245 Crocosphaer...
jgi:Cal6303_4524 178 PVFQTI--DNLTSIRSVLPKISEIVVSMDNLLL------NYLDIQSPLVMQPVWKTVGKTSKLFTNCLDMFIWSDFAFTR 249 Calothrix s...
jgi:Cri9333_2555 176 PVCSKI--NDWSSAKSVLPVIPLLIQAIDRLLS------DNIEIQQPLVIQPIWKTQGKTFTLYENCLDIFVWSDFAFTR 247 Crinalium e...
jgi:Anacy_0948   175 PVCSQI--EDWLSIRQVLPFVSQLVECLDNLLA------DYIEIQSPLVMQPIWKTVGKTSKLYQNCLDIFVWSNFGFTR 246 Anabaena cy...
jgi:Syn6312_0093 172 PICSQI--QNWQDKNEILIHLSHFKQAMIDVISfllnqkQKIYTQQPLVIQPVWKTLGKSSTLHDNCLDTFIWSDLALIL 249 Synechococc...
CDE68160         170 NSCSSI--QMWDNDFEMTHKMATICQSINDFQS------QYYQHQKPLLMQTIWKTQGKSPLLAEQAFDIVIWSDYAFSR 241 Clostridium...
WP_009291115     170 DACSSI--QMWDNDYEMTHKMPLLCQAVDDFQL------KYYSHQKPLLMQTLWKTQGQSPILADQAFDIVIWSDYAFSR 241 Anaerostipe...
jcvi:PRU_0665    187 TIGSEI--KNWSEIRQVLPHYKAICKAILDVSI------DLSNKQIPLIIQPIWKTDKKLKDFADDCLDVFVWSNLSVIQ 258 Prevotella ...
CCX40468         169 DAGRNV--RDWTEAGEVLPYMDEIYWAIRRMVS------EKNECQSPIIMEPVWKTEGKSPRLADHCLDLFVWSNFGMLN 240 Firmicutes ...
BAI88192         176 PQD-----LDWTEPLSVIPYVSTMIEAIDNLMS------HIVLGQKPFLMQPIWKTQGKSPQLSTNCLDVFIWSDICFSR 244 Arthrospira...
P44999           148 DIPNNVdhLDWSEPKQVIPLFPHILSTLNNLCS------RADTIQTPFLLQPVWKTLGKSPRLADNCLDIFIWSDVAFVK 221 Haemophilus...
kribb:BBB_0113   273 LFL---VSAANRndpnAEITRPERSLIWLVRSLYDYACQGKVKFDWAHSAITYNQQTDKAGSFAGNIPFQFMNGPRLRKP 349 Bifidobacte...
jgi:PCC7418_3643 251 LFIdvcKSSSNR----QKITRHYRTAIWLAKMLVDFSKKGKIDQRGVIDNLTYDTKNDKAFAVSGKITRRYMKCDQITSP 326 Halothece s...
WP_009543215     246 LFIdaaKLELNS----EKITRHKRCVVWLAKMLYDFANTSKINHTVTIDEISLNTKNDKAFALSGSRTHKYMKSPELTNP 321 Crocosphaer...
jgi:Cal6303_4524 250 LFFdvaKKAAKNa---ETITRSTRSVVWLAKMLYDFASNGKINHQFIIDNYTYNTKNDKAFAINGIGTYGYMKSPQLINP 326 Calothrix s...
jgi:Cri9333_2555 248 LFFdisKNFTKEn--lEVIQRPMRSVVWLAKMLYEFATNGKMNHKLIIDSLTYHTKNDKAFALSGNVTRLYMNCPELITP 325 Crinalium e...
jgi:Anacy_0948   247 LFFditKRLAKSe---ETIQRPMRSVVWLAKMLYEFALVGKINHKLIIDTLTYNTKNDKAFALSGSNTRRYMTCDNLIHP 323 Anabaena cy...
jgi:Syn6312_0093 250 LPLhqiNTSRRT----QNISRPARTIIWLIKMLYDFIINGQINIAQVIDTLTYDTKNDKAFAASGRVTHPFLSSPELTQP 325 Synechococc...
CDE68160         242 LFVdssTSPANT------MSRPMRATARLARCLWELSKSGKIRVADIYRQMAFGNQTDKEFAISGSKWRQYVKSDRILRP 315 Clostridium...
WP_009291115     242 LFLdhsAEPAET------MRRGMRASARLARCLWELSKSGKIRVVDIYRQMAFGNQTDKEFAVGGSLWRKYVTPNRIQNL 315 Anaerostipe...
jcvi:PRU_0665    259 MCLretNAD-------NDISRNQRTIIWLYKMLWDFSLYGSFNYTGIVNELAYNYKTDKAFSISGKLTNPLMRCPELTKP 331 Prevotella ...
CCX40468         241 LFMpeeNEEFRT------ITRHTRTMIWLFKMLQEYAEKGRFNGAKIIDTLSYNLKNDKAFASNGLRTHPIMTCAELTKP 314 Firmicutes ...
BAI88192         245 LFVnlaKQEIKTfgkiIKISRYTRTVIWLYKMLSDFADRGLFDYVSIIDSCSYNTKNDKAFAVNGKITHEYMKSEYLRKP 324 Arthrospira...
P44999           222 FILeisNLNVNV----LSINRQTRTAIWLYKMLVDIVKYGRFNHHKIIDLCSYNTKNDKAFASSGMITNVFMKSERLERP 297 Haemophilus...
kribb:BBB_0113   350 AIPRDQLDDVIPMEALDLFMPERRLDATLF 379 Bifidobacterium bifidum BGN4
jgi:PCC7418_3643 327 RIKRNEIKNIILNEGERMLSPERRFDAAIL 356 Halothece sp. PCC 7418
WP_009543215     322 RIKREEINNIILGGGEKLLSPERRFDAIIL 351 Crocosphaera subtropica
jgi:Cal6303_4524 327 RIKKEEIKNIILGGGQNYLSPERRFDGIIL 356 Calothrix sp. PCC 6303
jgi:Cri9333_2555 326 RVNKSEIKNIILGGGQNFLSPERRFDAVVL 355 Crinalium epipsammum PCC 9333
jgi:Anacy_0948   324 RITKEEIKNIILGGGQNFLSPERRFDAIIL 353 Anabaena cylindrica PCC 7122
jgi:Syn6312_0093 326 RIKKSEIKNIILNGGQNLLSPERRFDAIIV 355 Synechococcus sp. PCC 6312
CDE68160         316 ILSKTVVNDIIEPGYIQKLSPERRFDQTLY 345 Clostridium sp. CAG:277
WP_009291115     316 ALKKDIVYQIIEPGYIDRLMPERRFDQTLY 345 Anaerostipes caccae
jcvi:PRU_0665    332 RISKYEIKNIILGDGQKLLSPERRFDAFIV 361 Prevotella ruminicola 23
CCX40468         315 RITKGEIRKVILGGGQYLLSPERRFDAIIY 344 Firmicutes bacterium CAG:102
BAI88192         325 RILKQEIKNIILGDGQNLLSPERRFDAIIY 354 Arthrospira platensis NIES-39
P44999           298 IIMKSEIKNIILGGGQELLSPERRFDAIIY 327 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap