Conserved Protein Domain Family
SSXRD

?
pfam09514: SSXRD 
SSXRD motif
SSX1 can repress transcription, and this has been attributed to a putative Kruppel associated box (KRAB) repression domain at the N-terminus. However, from the analysis of these deletion constructs further repression activity was found at the C-terminus of SSX1. Which has been called the SSXRD (SSX Repression Domain). The potent repression exerted by full-length SSX1 appears to localize to this region.
Statistics
?
PSSM-Id: 401460
View PSSM: pfam09514
Aligned: 13 rows
Threshold Bit Score: 33.8952
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_016277715 168 RRKDVEVHIYSLRERK-YQVYQEMWDPQDDD 197  gray short-tailed opossum
XP_027819084 607 ERKTVDVWANRLRKRQ-PVAYEEISDSEEES 636  sheep
EHB09429     164 RKRKVSVWSKQLREWKnLMVYEEISDPEEED 194  naked mole-rat
XP_005641362 193 KRGKNSIWAYRLRERKnLVVYEEISDPEEED 223  dog
XP_023374805 160 KKKGKSVWAHRLRERKnFIIYEEISDPEEED 190  small-eared galago
XP_017193924 172 RRKNIEVKMYSFRKRK-SQAYKECSEPQDDD 201  rabbit
Q96EQ9       172 RKKNVEVKMYRLRERK-GLAYEEVSEPQDDD 201  house mouse
1_pfamImport   2 RRKEIEARSYNLRERT-DRSYEEVSEPQNDD 31  
ELK10079      99 RRKGVEVKMYSLRERT-GRVYQEVSEPQDDD 128  black flying fox
XP_011962445 172 GRKETDMKRYSLRERK-GHVYQEVSEPQDDD 201  sheep
Q9NQW5       172 RRKETEGKMYSLRERK-GHAYKEISEPQDDD 201  human
ELW61807     191 RRKETKVKMYSLRERK-CGTYKEVHEPQDDD 220  Chinese tree shrew
XP_006527711 131 GGIQVNVWSHRLRERKyRVIYSEISDPEEEE 161  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap