Conserved Protein Domain Family
Dimeth_Pyl

?
pfam09505: Dimeth_Pyl 
Dimethylamine methyltransferase (Dimeth_PyL)
This family consists of dimethylamine methyltransferases from the genus Methanosarcina. It is found in three nearly identical copies in each of Methanosarcina acetivorans, Methanosarcina barkeri, and Methanosarcina mazei. It is one of a suite of three non-homologous enzymes with a critical UAG-encoded pyrrolysine residue in these species (along with trimethylamine methyltransferase and monomethylamine methyltransferase). It demethylates dimethylamine, leaving monomethylamine, and methylates the prosthetic group of the small corrinoid protein MtbC. The methyl group is then transferred by methylcorrinoid:coenzyme M methyltransferase to coenzyme M. Note that the pyrrolysine residue is variously translated as K or X, or as a stop codon that truncates the sequence.
Statistics
?
PSSM-Id: 370535
View PSSM: pfam09505
Aligned: 7 rows
Threshold Bit Score: 775.487
Threshold Setting Gi: 302204109
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AGY50178             8 RGDGKRLYLSRQQILDDINEGIADAADIASVPNLTSDDIDFLLEILIDSNRTVGVEVGKEVVLTYDIGQIDLEGDTGNSG 87  Candidatu...
licsiro:TALC_00301   1 MGDGRTVYMTRENVLEDIRKGMADAADAAGVPDLNENEIEQMADVICSDERLVSVPRGHEVVMSEDGGPYKMMIDSGSSG 80  Thermopla...
AGI85870            10 MGDGKRVTMTKEQIMADLQAGTADAADMGSIPALTADDLERLADIICDKNRIVAVEPGNEVVLTYDIGQLDFTGDNGNSG 89  Candidatu...
jgi:Acear_1273       9 LGDGSTIEMTEDEIRADIERGIEDAVDRAEVDSLPEEEIEKLTDIYTRPSKFVSVETGNELVLTFDEGSVKLKR------ 82  Acetohalo...
jgi:Metev_1439       9 MGDSTTEYHSKDRIMEDIEAGTNDAAELGGIPALSDDDKEKIADILMSPQKMVSVDAGNEVPVTHDIGTLRIDGDQGNSG 88  Methanoha...
Q8TS72               9 MGDGKRIFLTKEKIREELEAGAANAADLGEIPALSGDEIDRLAEILMMPGKAVSVEQGMEVPVTHDIGTIRLDGDQGNSG 88  Methanosa...
jgi:Mzhil_0605       9 MGDGKRVYHSKNQIMDDLEAGSADAADLGEISALSGDELEKLAEIIMTKSRMVGVEPGKEVPVTHDIGTLRIDGDQGNSG 88  Methanosa...
AGY50178            88 LGIPISRLTGALTHERAMGADTFELAHADYSIKPVKPIIANEMQAMETAQNNLVIPYFYGAMPNMGLYYSPDGPYGNPAD 167 Candidatu...
licsiro:TALC_00301  81 NGIEISRLQAILAHERTLGMDSFQLAHIDYSIKAVKPIIGYEAQAMEQINMLSTVPLLYGAMPNMGLYYAPDGPFGNPAD 160 Thermopla...
AGI85870            90 NGVDMGRLEAALIHERALGADTFELAHSDYSIKPVKPVIAMEMQTMEEIQQEIVAPYFYGAMPNMGLYYAPDGPYGNPAD 169 Candidatu...
jgi:Acear_1273      83 LAVSIGRIPDLQIYERVFCSDTAELAHIDYSFKPVKPIVAEEQIEMEQALLSTVLPLYYGAMPNLSLYSQPDGAFPNPAE 162 Acetohalo...
jgi:Metev_1439      89 TGIPASRLTGVMTHERAFGTDTMELGHIDYSFKPVKPVVSQECQTMEVCQQNMTVPLMYGAMPNMGLYYQPDGPFKNPSD 168 Methanoha...
Q8TS72              89 VGIPSSRLVGCMMHERAFGADTMELGHIDYSFKPVKPVVSNECQAMEVCQQNMIIPLFYGAMPNMGLYYTPDGPFENPGD 168 Methanosa...
jgi:Mzhil_0605      89 VGIPSSRMIGCMMHERAFGADTMELGHIDYSFKPVKPVIAQECQAMEVCQQNMIVPLLYGAMPNMGLYYTPDGPFENPGD 168 Methanosa...
AGY50178           168 LMREFKIQEARESCEAAVDHLARDIHFVSTKIMSAGADGFDFDTTASAGDGDFVATLRGVEMLRKECPQAYINLGMSGEL 247 Candidatu...
licsiro:TALC_00301 161 LMREFKMEEAMDQAEKAAAQIAADIDYVFSGMMAAGSEGWNFDTTASAGDADFVGTLNGITEVRKKFPNAYIEMGMAAEN 240 Thermopla...
AGI85870           170 LMREFKIDESMQQSELAAEHMARDIEYVGNKIISAGADGFDFDTMASAGDADFVGGLKGVEALRKANPLAYINTGMAGES 249 Candidatu...
jgi:Acear_1273     163 LLPKGKVKEAQEAYEGMMEHAIKDMVFVGSKMYEAGADGINFDTTGSAGEPDFLATLKATEELKEKYPNISIEMGMAGEF 242 Acetohalo...
jgi:Metev_1439     169 LMREFKLQEAKKEIEGAADELTNDMVWTVDKLYKSAADGVNFDTIAAAGDGDFYATLNAIEALRKRFPNMYIEAGMASES 248 Methanoha...
Q8TS72             169 LMKAFKIQEAWESMEHAADHLTRDTVWIMQKLFASGADGVNFDTTAAAGDGDFYGTLHAVEALRKEFPAMHIEVGMAGEM 248 Methanosa...
jgi:Mzhil_0605     169 LMKAFKIAEAQESIEKSADHLTRDMIWIIQHMMKSSSDGVNFDTTGAAGDGDMFATLHAVEALRKEFPEMYIELGMAGEC 248 Methanosa...
AGY50178           248 VLGIHGELEYDGQIVAGLCPHQQVKLAAKAGASVFGPVVNTNTGKSLAWNLARALTFIKECVKVSPIPCHANMGMGVGGI 327 Candidatu...
licsiro:TALC_00301 241 VLGIHGSIEYDGTPVAGLYPHQQVKLAEKAGVNIFGPVVNTNTSRSFAWNIARAVTMVKECEKVSNIPCHVNMGMGVGGI 320 Thermopla...
AGI85870           250 VMGIHGGIEFHGKTVAGLFPHQQVKMCEEAGANVFGAVCNTNTSKSLAWNMARAVTFVKECVKQASIPVHCDLGMGVGGI 329 Candidatu...
jgi:Acear_1273     243 VLGMHGDLEYNGVGLAGLYPHEQVKLAEEAGVDVFGPVVNINSSETIPWNIGRTVTMMKACAEAADIPVHANVGMGVGGV 322 Acetohalo...
jgi:Metev_1439     249 ILGMHGEFEYDGTTLAGLWPHEQAPLLGKAGANLFGPVCNTSTSHSTSWNLARAVTFVKSAVDKSPIPCHVNMGMGVGGI 328 Methanoha...
Q8TS72             249 VLGMHGNLQYEGVTLAGLWPHQQASLVAKAGANVFGPVVNTNTSKTSPWNLARAVTFIKEAVKVSSLPCHVDMGMGVGGI 328 Methanosa...
jgi:Mzhil_0605     249 VLGMHGGLEYDGKTLAGLWPHQQAPLVTKAGANVFGPVVNTNTSMSFSWNLARAVTFIKAAVEASDIPCHVDMGMGVGGI 328 Methanosa...
AGY50178           328 PMTETPSLDAMTRCSKAMVEIAGVDGIOVGVGDPAGMALPHYVSSGMGGIRTAGDLVARMEYSKSMKISEAKEYVAKKLG 407 Candidatu...
licsiro:TALC_00301 321 PMSECPPLDAVSRANKLMVEIAHVDGIOAGAGDPLGMSNAHVAASGMGGVRTAGDLVARMEFSKNMKLAKAKEYVAKKLG 400 Thermopla...
AGI85870           330 PMFETPPIDAVTRASKAMVEIAKCDGVOIGVGDPVGMDMAHMLASGMGGIRTAGDLVARMEYAKNMKVDKAKEYVAKKLG 409 Candidatu...
jgi:Acear_1273     323 PIVETPPADSLSRASAALAEIGKQDGLOVGVGDPNGMVISHALASGMGGVRTAGDLVARMQMSENMRLDEAKEYVADKLG 402 Acetohalo...
jgi:Metev_1439     329 PMFETPPVDAVTRCSKAMVEVAGVDGIOVGVGDPVGMPIAHVSASGMTGMRAGGDLVARMQLSKNMRINEAKDYVSKKLG 408 Methanoha...
Q8TS72             329 PMLETPPIDAVTRASKAMVEVAGVDGIOIGVGDPLGMPISHIMASGMTGIRAAGDLVARMQFSKNMRIKEAKKYVAKKLD 408 Methanosa...
jgi:Mzhil_0605     329 PMLETPPIDAVSRASKAMVEVAGVDGIOIGVGDPMGMPISHIMTSGMSGIRAAGDLVARMQFSKNMRIGEAKKYVADKLG 408 Methanosa...
AGY50178           408 VSSIDLADEYVMKDLREELGLGVVTAIPGVPKGIAAKMNIERLLDTKINCCEHFRN 463 Candidatus Methanomassiliicoccus ...
licsiro:TALC_00301 401 ISEIEIADETVMRDLRYDLGLGNVTSIPGAAKGMEAKLNIEKVLGITINSCEKFRG 456 Thermoplasmatales archaeon BRNA1
AGI85870           410 LSTLDIADEHVMRDLREELKIGVVTGLPGAPRGIAAKMNIEKLLDIKINSCEKFRQ 465 Candidatus Methanomethylophilus a...
jgi:Acear_1273     403 VEVGELTDPVIMDEVRNELNIGRVQPEAGEAKGVEAKFNISELLDIRINSVEKFKN 458 Acetohalobium arabaticum DSM 5501
jgi:Metev_1439     409 VEPMDLSDEYVMRDLREELGIGVLTSVEGAPKGISAKMNIEELLDIKINSCEKFRN 464 Methanohalobium evestigatum Z-7303
Q8TS72             409 VDVMDLADEHVMRELREELDIGVITSVPGAAKGIAAKMNIEKLLDVRINSCELFRK 464 Methanosarcina acetivorans C2A
jgi:Mzhil_0605     409 VTPLDLSDEFAMREIREDLGIGVITSVTGAPKGIAAKMNIEKALDIKINSCEKFRN 464 Methanosalsum zhilinae DSM 4017
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap