Conserved Protein Domain Family
RE_Bsp6I

?
pfam09504: RE_Bsp6I 
Bsp6I restriction endonuclease
This family includes the Bsp6I (recognizes and cleaves GC^NGC) restriction endonucleases.
Statistics
?
PSSM-Id: 401453
View PSSM: pfam09504
Aligned: 2 rows
Threshold Bit Score: 362.07
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCZ79469       1 MIRKENYLDILERETPINIIQYEEEDMFLLQKLYSDWMNLNEKIKQIGGRPSSLPSEFVEALVAYKMGYWRIDNMSVGFD 80  Roseburia sp. C...
1_pfamImport   1 MIRKENYLDILERETPINIIQYEEEDMFLLQKLYSDWMNLNEKIKQIGGRPSSLPSEFVEALVAYKMGYWRIDNMSVGFD 80 
CCZ79469      81 CFDPNAPKGKNRIEIKYATGRMDFSSFSPEIKWDRLNFVKFYNESPEDCYFEVYDIDIQMIFEESERFGRYIYDRRGCRP 160 Roseburia sp. C...
1_pfamImport  81 CFDPNAPKGKNRIEIKYATGRMDFSSFSPEIKWDRLNFVKFYNESPEDCYFEVYDIDIQMIFEESERFGRYIYDRRGCRP 160
CCZ79469     161 RISVIRELIERGIYNEKRE 179 Roseburia sp. CAG:18
1_pfamImport 161 RISVIRELIERGIYNEKRE 179
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap