Conserved Protein Domain Family
DUF2388

?
pfam09498: DUF2388 
Protein of unknown function (DUF2388)
This family consists of small hypothetical proteins, about 100 amino acids in length. The family includes five members (three in tandem) in Pseudomonas aeruginosa PAO1 and in Pseudomonas putida (strain KT2440), four in Pseudomonas syringae DC3000, and single members in several other Proteobacteria. The function is unknown.
Statistics
?
PSSM-Id: 401450
View PSSM: pfam09498
Aligned: 35 rows
Threshold Bit Score: 63.0464
Threshold Setting Gi: 317465913
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAN47262        37 LLSTGATSASTYLTSGgDHKLVGPVSDDASTFIASDGAIRGPYLEAELQRIRSENPGLsESSDLELAGAILS 108 Pseudomonas resinovor...
Q88GI0          28 VATSAGISASLYSTFK-DDKRIIPARDELSAFVASGGTIRGAYVESALEQARKDHPGL-QANDEELARAILS 97  Pseudomonas putida KT...
Q88CJ0          29 VMTSGATTASSYLTSR-DHKLVVAAQDDASSFVASEGAIRGPFLEAAMREARAENPGM-QASDMELANAILA 98  Pseudomonas putida KT...
PNU:H681_01500  31 VLTSGATTASSYLTSRdDHKLVGPAQDDAASFIATDGAIRGPYLESALLQMRSANPALaNASDAELASALLA 102 Pseudomonas sp. ATCC ...
WP_012020080    29 ILSSGATTASTYLTFK-DRKLVAAAEEDASSFVASAGEIRGPHLEAALQQLRSDNPQLrDSDDMALASAILA 99  Pseudomonas
WP_011911504    28 ILSSGATTASTYLTFK-DNKLVIPAREDAGTFVASNGEIRGPYLEAMLQQLRSEQPQL-QATDMELASAILA 97  Pseudomonas
jgi:Psefu_0503  28 VLSSGATTASTYLTFK-DNKMIVPAQDDASSYIASNGEIRGPYLEAALQKIRTDNPDL-QASDMELATAILT 97  Pseudomonas fulva 12-X
WP_016495290    30 VISSGATTASTYLTFK-DDKLIVAARDDASSFVASGGEIRGPYLEAALQHIRSEHPDL-KASDTELASAILA 99  Pseudomonas resinovorans
PNU:H681_01495  29 IISSGATTASTYLTFRhDHKLIAAAQDDAGTYVASDGAIRGPYLEAALNRLRSDDPGLrQRSDMELANAILT 100 Pseudomonas sp. ATCC ...
PNU:H681_11885  28 iATSLGTAAASESTSH-SVRTYKAAHNDALAFVASDGAIHGAQLEQALREYRQEYPRS-TLDDGELAQAIAS 97  Pseudomonas sp. ATCC ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap