2WVK


Conserved Protein Domain Family
Osmo_MPGsynth

?
pfam09488: Osmo_MPGsynth 
Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth)
This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP) EC:2.4.1.217, comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
Statistics
?
PSSM-Id: 401440
View PSSM: pfam09488
Aligned: 23 rows
Threshold Bit Score: 479.828
Threshold Setting Gi: 367051406
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WVK_A                 5 IPNHTERFGVVRLHEVQRILELDSGrv--rdESPAVGLRRLDDADLRDVLEQTAIVVPTRNERLKLLEGVLSGIPHEALI 82 
jgi:Smar_0498          5 MPRYMERFGAVRFYDVQRVLELSGGkts-dfGGEVPGTINVSSSDIEEIEANMTIIVPVKNENPKVLEGVLSGIPHDAFV 83  Staphyl...
Q9YDM5                 5 LPAKFEVFGAVRIYDVSRVLSLDGRp-----KSRPTNLVYVDRGELEDAAFRTVIVVPVKDEDLLTLENVLRSIPTESPV 79  Aeropyr...
WP_012939989           5 LPKHSEVFGSIKIHELQKVLKLESS------KVIAPLIRGFSRDELREIFSRMAVVIPVKDERLHLLDGVLRSIPDDCTI 78  Archaeo...
WP_013413622           5 TPRHFETIGAVKLYDIQRVIKLDSE------LSDNPLFYTFSKSDLHKVLNDLSIVIPIKNERINLFDGALRSIPHNCPI 78  Methano...
WP_013683991           5 APRHAEIFGSVKIYDVQKVLKLESK------EIEGPLLRSIGREQIEEVLEKLSIVIPIKNEKIKLLDGVLKAIPDACQI 78  Archaeo...
WP_013683670           5 APRHAEIFGSVKIYDVQKVLKLDSE------KIDTPLLRSFSKDEIEEVLNKLSVIIPIKNEKIHLLDGVLRAVPRSCPI 78  Archaeo...
goetting:Ngar_c27190  21 LPRYTERFGATSLHGVQRVYELDSGfd--dgKSMSETLMKVGNEQISEIERKMAIVIPIKGERLRLLEGVLSGVPHDCLV 98  Candida...
jgi:Dehly_0877        15 RTRQAEHLGSVTIYGVRRVLELDSGakn-pqVAENSDVQKVEREAIDEIERKMVIVLPIKDEDAKVFEGVLSAMPHDCFI 93  Dehalog...
Q3Z6S5                 5 SLRPAEHLGNVTIHGVRRFLELDSGapslphLQESREVEMVDQQAISDVEKKMAIILPIKDEDLKVFEGVLSGIPHDCLM 84  Dehaloc...
2WVK_A                83 LVASNSSP---DRFQMERDLLEEFAHLTERPALIFHQKDPALAEALRAGGYPHPIGEDG-LVRSGKAEGMILALVFAALS 158
jgi:Smar_0498         84 VVVSNSKRepiDKYRIELDTLFQFYRLTRRPLMVVHQKDPVLGQALKEAGYPYIVGDNG-YVKDGKGEGMIVGLLLAKYL 162 Staphyl...
Q9YDM5                80 VVVSASTRepvDRFSNEVELARLISRSLQRDIAIVYQFDPAWSEALSGTPLESMVGASG-RVRKGKGEGMLLGFIVAAAL 158 Aeropyr...
WP_012939989          79 VVVSNSRRveqDVFKLECDLVSNFYKISNQRIAIVHQKDPGLSLAFQEVGYNAILDKTG-VVRDGKGEGMVIGILLAKMF 157 Archaeo...
WP_013413622          79 IVVSNSNEk---RCKVEKEVVKQFYNVTEHPIMYIHQKDPNVALAFKELKYYDILNGKGeFVRDGKGEGMIIGILVAKAI 155 Methano...
WP_013683991          79 IVVSNSSRtghDVFRMEADVITHFHSLTKHPICIIHQKDPGLALAFKEVGYTSILDESG-FVRDGKAEGMITGTLLAKCL 157 Archaeo...
WP_013683670          79 IVVSNSQRgkrDVFKMERDVIAHFHNLTKHPVTVIHQKDPGLGLAFKEVGYDRILDENG-FVRDGKAEGMIAGLLLAKHM 157 Archaeo...
goetting:Ngar_c27190  99 IIVSNSPRqpvDRYMLEKDALQQFNKFVGRNALILHQRDPGLSEALNEVGYTSMLGPDG-VVRSGKAEGMVLGMLLAKMA 177 Candida...
jgi:Dehly_0877        94 IVLSNSQRgdiDAFRIEHDILSRFCQITRRQAMLVHQKDPAVAKAFVEAGYPEILGEDG-LIRSGKSEGMILGIMLAKVL 172 Dehalog...
Q3Z6S5                85 IVISNSSKqevDNFKNEKDIVSRFCRITHRQAIVVHQKNPELAGAIADAGYPELLGKDG-LIRSGKAEGMILGIILTMFS 163 Dehaloc...
2WVK_A               159 GRRYVGFIDADNYFPGAVWEYVRAYAAGFLMAKTPFAMVRILWRYKPKLTEDEgVVFRRYGRVSERNNRALNQLIGGVSG 238
jgi:Smar_0498        163 GRKYVGFIDSDNYIPGAVNEYVHIYAAGFYMAKSPFAMVRIKWPYKTKFVGKR-FYFRRRGRVSEITNRYMNLLVASITK 241 Staphyl...
Q9YDM5               159 GADFVGYVDSDNYVPGSALEYSWIYYSALSRATSSYSMVRIVWPYKGKLAASD-MYLRKRGRVSTITNGVLNYTLSIYKR 237 Aeropyr...
WP_012939989         158 GCDYVGFVDADNYIPCSVNEYVSIYAGVLSLAETPYAMVRLHWRYKPKVMEDR-LYFRKWGRVSEITNKYINMLLSMKTG 236 Archaeo...
WP_013413622         156 GSKYVGFVDADNYLPSSIYEYVLDFAAGIKMSKSPYSMVRLRWKYKPKLIKNK-VYFKRWGRVSRVTNKFLNKLIGHYLG 234 Methano...
WP_013683991         158 EKDFVGFIDADNYIPGAVNEYVKDFAAGFCMSESPYSMIRLHWKHKPKIVKSR-LYFRKWGRVSEITNKYLNFLLSNCTG 236 Archaeo...
WP_013683670         158 GKEYVGFVDADNYVPCAVNEYIKDFAAGLCMSESPYAMVRLHWRHKPKIVKSK-LYFRKWGRVSEVTNRYLNLLLAAQTG 236 Archaeo...
goetting:Ngar_c27190 178 GKEYVGFIDADNYVPGAVNEYVKIFASGIAMSKTPYTMVRVSWIYKPKMSETG-LYFSKWGRVSELTNQHLNSLISYYTG 256 Candida...
jgi:Dehly_0877       173 GKDYVGFIDTDNYIPGAALEYAKHYAATFSIAKTPYVMTRIQWRYKPKMYGE--LYFKKWGRVSEITNKHLNNMISTMGQ 250 Dehalog...
Q3Z6S5               164 GREYVGFIDTDNYIPGAVWEYAKHFATGFNLAQSPYSMVRVLWKYKPKLVGD--LYFKRWGRVSEVTNKHLNHLISSKGK 241 Dehaloc...
2WVK_A               239 FETDVVKTANAGEHAMSLGLALRLPLASGYAVEPQELVSLLELYggvfpledeevlqHGVEIFQIETRNPHLHENKGDEH 318
jgi:Smar_0498        242 FETDIIKTSNAGEHAMTLELVDRIGYSSGFSIEPYQIVYMLEEYtglkqtrfpevmkNTIEIFQIEPRNPHIHEEREETH 321 Staphyl...
Q9YDM5               238 IETDIIKTGNSGEQALTVKLGMEMNWGSGFAVETYQLVWMLENCylglqagkcpiapDYIEVRQVSPLNPHIHAERGDEH 317 Aeropyr...
WP_012939989         237 FETLIMKTGNAGEHAMTMKLAEIMEFSTGYSIEPYQIIYLLEEFwegetr-fkdalsSGVSIYQVETINPHVHEEKGEEH 315 Archaeo...
WP_013413622         235 YKTTIMKTANSGEHAMSIELANKLAYSSGYSIEPFEIIYILENFgks-------dgnKIVEIFQIETLNPHIHENKGEEH 307 Methano...
WP_013683991         237 FETDIIKTGNAGEHAMTMELASIMCYSTGYSIEPYQLVYLLEEFgkgete-crdvvnSGVEILQIEMLNPHLHEEKGEKH 315 Archaeo...
WP_013683670         237 FETHIIKTGNAGEHAMTMRLAEIMGYSTGYSIEPYQYIYLLEEFwkgegr-yseatsAGIEVFQIETLNPHIHEEKGEKH 315 Archaeo...
goetting:Ngar_c27190 257 FETEVMRTGNSGEHCMSLKLAELLTFSSGYSIEPYEIVNVLEEFggiiptsyqdamdKGVEVMQVETRNPHFHEDKGEDH 336 Candida...
jgi:Dehly_0877       251 FETDVFKTGNAGEHAMSVALAERLNFGTGYAVETEELISILEKFtgmlpienkeaseKGVEIFQTETVNPHLHAEKGDEH 330 Dehalog...
Q3Z6S5               242 FETEIIKTGNAGEHAMSIELAKRLTYGTGYAVETKEIMSILEQFsgilpiedrevaeEGVEILQTETINPHLHEDKGGDH 321 Dehaloc...
2WVK_A               319 -IRDMLLACLATVYHSKLATEEVRQSVLEELQAAGALAPGe-EPPPPVLYPPLSSLDLQAVRKA 380
jgi:Smar_0498        322 -IPEMIKQSLATIYHSRLADEFLKNRIREELLARRAISRDe-EIPEPVKYPPLIEADARKIFKI 383 Staphylothermus marinus F1
Q9YDM5               318 -IAEMTAVSLGTIFHSSLASEEVKSRILDQLKSLGLAE----EPPKPSTYRP-AGTDPKKVFAS 375 Aeropyrum pernix K1
WP_012939989         316 -IKDMLLASLAVIYHSKLAKDELKDKIFEELKNNEVVKSRr-DIKKCVKMPPICDIDLKKFIEV 377 Archaeoglobus profundus
WP_013413622         308 -INNMIHDSLSTIYHSKLANKNIKLEIIEELKKRNVLKDKe-EPKKNIMMSPIETLDEKSFIEI 369 Methanothermus fervidus
WP_013683991         316 -IKDMLLGLLSTIYHSKLCNEYLKSKILEELRTNNAIGQEq-APKKNLIIPPIKDIDIKKFIKV 377 Archaeoglobus veneficus
WP_013683670         316 -VKDMLHDSLSTIYHSRLSDRQLKSKILEELKANNVLKEGe-KPRKNITIPPIKEIDVNSFMKI 377 Archaeoglobus veneficus
goetting:Ngar_c27190 337 -LKEMVVASMGSIYHSKICPPKLREKILESLRTRNMLEEGqqEPPAPVKIDPFKDIDIRQFAKV 399 Candidatus Nitrososphae...
jgi:Dehly_0877       331 vLNEMMQPSLSVIYHSPLSQERIKAQILDELVEAGCLESGq-EPPPVTLMPPPQQADLDSFSAA 393 Dehalogenimonas lykanth...
Q3Z6S5               322 lIQDMLLPSLAVIYHSPLADESVKKKIENQLAGIEGLENNp-EIPQVKLIPPPQKMDLAKFSAV 384 Dehalococcoides mccarty...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap