Conserved Protein Domain Family
HrpB2

?
pfam09487: HrpB2 
Bacterial type III secretion protein (HrpB2)
This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow group of species including Xanthomonas, Burkholderia and Ralstonia.
Statistics
?
PSSM-Id: 370524
View PSSM: pfam09487
Aligned: 8 rows
Threshold Bit Score: 107.504
Threshold Setting Gi: 81606363
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q63JU1         23 AAPAGAGAPaaAPvpaEVAGRFQALMSNAVPT--PP-LAHAQETSAIAKLVETSDAEIRKVLDNVEYLNLHANEMTMN-- 97  Burkholderia p...
CBW77107       26 AQDADKTMP--SP---EAVSRFQALMQQADVA--APtTEPSGEMSALSRIVGTHDVQMEQVLNDVDALQHNMGNLSPG-- 96  Paraburkholder...
ACR30709       19 KPEAASGSP-------AAADKFKALMEKPSMA--PPhAEQSHSLEVASKLVAAQDAELQRSVTDAAEFMQRAPEMSLN-- 87  Burkholderia g...
Q8PB91         17 STPAVSPTA--APn-qSLVNRFQALMQSSCPL--PPaMQRVGEPSMISRMVDMQNDGVRAMTEHVDAFGANAPKMGLE-- 89  Xanthomonas ca...
WP_011004163   20 ALPAVQPEPv-----qELVSRFEALLGQAKDA-----QRHSKGPSAIGELVAKEDAAVRATADRINATLETDKVKPME-- 87  Ralstonia
nioo:CFU_4340  28 AAAAGGVTP--APr-sDLVEQFRAKFEQARLS--PQsVTHFQGPSAVSEMITQQDQAMGTLTGKVDAFAAGADKMSMQ-- 100 Collimonas fun...
WP_011793650   13 AIESGAAQP--SNl-sALAEKFARMMEGKPQA--P--LAEMAPDSTLGNALMHQDESMRKALQDMHALAHAQKDNSMNdi 85  Acidovorax
WP_013902321   28 laaqagnGP--NPsmeELTQRFKALMDAPHPVerPPsGPQ---DSMLTHMLANGEEFLRQTHEKVAELRAQSPYMTPA-- 100 Ramlibacter ta...
Q63JU1         98 QMFAASLQASAEATAMQIDMQAKMGVVTSTKDAIGSLMKNQ 138 Burkholderia pseudomallei
CBW77107       97 ETAAASNLVMTRVANLQVETTVAMSLTTSTKGSIETLLKNQ 137 Paraburkholderia rhizoxinica HKI 454
ACR30709       88 EMNAGSIRLTYELASTQLDMEAKMGVVNASKSSIETLMKNQ 128 Burkholderia glumae BGR1
Q8PB91         90 EIAAEEMKLINELTMVGFNLNVSVSLAQSGKNAVQTLFKNQ 130 Xanthomonas campestris pv. campestris
WP_011004163   88 EILVDAMRIQMEAAATMTKIHMGSMVAHSGKNAVQTLMKNQ 128 Ralstonia
nioo:CFU_4340 101 EVVAQSVKVQLDVATLTAKLYLGQTLAQGSKGAIQTLVKNQ 141 Collimonas fungivorans Ter331
WP_011793650   86 DMTSRQIELMYRVSGMQFQFHAMVYLAQSGKSGLQTLMRNQ 126 Acidovorax
WP_013902321  101 EFISASIEVSEAASIGHFRLQAATSIASGTNKSMQSLLKNQ 141 Ramlibacter tataouinensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap