4DF9


Conserved Protein Domain Family
Peptidase_M64

?
pfam09471: Peptidase_M64 
IgA Peptidase M64
This is a family of highly selective metallo-endopeptidases. The primary structure of the Clostridium ramosum IgA proteinase shows no significant overall similarity to any other known metallo-endopeptidase.
Statistics
?
PSSM-Id: 401429
View PSSM: pfam09471
Aligned: 9 rows
Threshold Bit Score: 327.456
Threshold Setting Gi: 81345419
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DF9_D           148 YLLKSGNEEQCIDVAILAEGYTTSEXETFYKDAAIACEALFSH-EPFQSXKNRFNIVAVASPSADS-GV--SAPKQGAWK 223 Bacteroides...
Q2IH26           174 EILKSGDPAHKLDLLLLGDGYTEAERGKFEKDARRLVAELFAH-EPFRSRKADFNVWGICPPAEEK-GV--SRPLTGVHR 249 Anaeromyxob...
WP_012099097     154 ALQDSGDPTAKLDLLLVGDGYTAKDRPKFEQDARRLLGTLFEH-EPFRSRRRDFNVWGLCPPTEEG-GV--SRPLTGIHR 229 Anaeromyxob...
jgi:Acid345_3935 206 ELQKSGPSSDKVDLLVMGDGYTADERGKFETDAKKFIETLFAT-SPFKEHRQDFNVWGLCPPAAES-GI--SRPSTGIHH 281 Candidatus ...
Q025W7           157 AVMQNGAPRDKVDLLLMGDGYTAAEMEKWHGDARRMAETLFAA-SPFKEHRQDFNVWAVDTPAEES-GV--ARPSDGVFR 232 Candidatus ...
Q2NQ58           100 ISRQGEVQKNKMIIAIMGDGYSFNDMEQWKKDANIVMSGFLSD-PLMNEFKDCFEFMRIDVISKDS-GI---SITGQQKK 174 Sodalis glo...
O86544            95 PLAETGPTADRLDVTIVGDGYTAAEQDDFLEDARAKWDEVTDI-DPYKSYEGLFNVWAVKAVSEDS-GVt-GDPTRDVVR 171 Streptomyce...
Q5ZUX5           191 qllpaV-KTPSLRVNIYAEGYTQSEKMKFWNRAIKTVQALQSQqFPGIDY---MDFYAVFNPSHKRlGVaeDLGLPVPEF 266 Legionella ...
Q08RZ3           155 PLLENGPPSEKVDLLILGDGYTAQERAKFEKDARRMVDILFTF-SPFKEHKARFNVWGLVPASAQS-GI--SRPSTGLHR 230 Stigmatella...
4DF9_D           224 HTAFGSHFDTFY-SDRYLTTSRVKAINDALA---GIPYEHIIILANTEQYGGGGIYNA-----F---TLTTAHHP-NFRP 290 Bacteroides...
Q2IH26           250 RSRVGSTYDAFG-SERYLLTFENRSMRDVAS---FAPYDALAILANGETYGGGGIFNL-----Y---ATVAADNR-WAGY 316 Anaeromyxob...
WP_012099097     230 RSRVGATYDAFG-SERYVLSFENRSLRDVAS---FAPYDAVAILVNAETYGGGGIFNL-----Y---ATVAADNR-WAGY 296 Anaeromyxob...
jgi:Acid345_3935 282 RSPLGTTYDTFD-SERYILTTENRAMRDAAS---FAPYEFVEILVNGKTYGGGGIFNL-----Y---GTVAIDNA-WANY 348 Candidatus ...
Q025W7           233 RSPLRAAYDVFG-SERYVLTFDNKRLREAAS---AAPYEFIEIVVNDRKYGGGGIFNL-----F---ATVSADNA-FTPY 299 Candidatus ...
Q2NQ58           175 DTALETVLGCYD-LDRLLCVNIKLVKKFANEslgFGGYDQVLVIGNTKEYGGAGYDGI---------GTLTMHKQ--SVE 242 Sodalis glo...
O86544           172 NTALGSYFWCGD-TERLICVDLDRTKAYADR---APATDLVIVVSNSAKYGGAGYSGLaadygYdgvSTLSSDND-RSTL 246 Streptomyce...
Q5ZUX5           267 DSFLGLYYPYWDnFGRWYHIVYPTRENKFRQglaSAPYDYPIVLVNNSQYWGVGNYKS-----H---TAIPADNStYFTY 338 Legionella ...
Q08RZ3           231 RSPVGATYDAFG-SERYVLTFDNEAFRDTAA---FAPYDFVEILVNGNTYGGGGIFGL-----Y---GTVASDSL-WAPY 297 Stigmatella...
4DF9_D           291 VVVHEFGHSFGGLADEYfYDEDVXNGLYPLNIEPWEQNITTr--iNFAS---KWEDXLTKTTPVPTPVADK--------- 356 Bacteroides...
Q2IH26           317 IFVHELGHHLAALADEY-FTSDTAYLSPEGRPEPWEPNVTA----DPKAa--KWGDLVAAGTPLPTPWPKDvftkranef 389 Anaeromyxob...
WP_012099097     297 VFVHELGHSLAALADEY-FTSETAYLSSEARPEPWEPNVTA----NPRAa--KWKDLLTAGVPLPTPWPKDeftrrakef 369 Anaeromyxob...
jgi:Acid345_3935 349 VGVHEFGHHFAGLADEY-YTSDVAYNSETKRKEPWEPNVTAl--lDPANl--KWKDLVENGTPLPTPWKKTefeefekgi 423 Candidatus ...
Q025W7           300 VFVHEFGHHFAGLADEY-YTSDVAYGSATERPEPWEPNATA----DPRAg--KWKDLLTAGIDLPSIWPKKayeqmeqai 372 Candidatus ...
Q2NQ58           243 LALHEFGHSAYHLADEYdYGNCVIEGD-----ENEKANVTKe--tDRNKi--KWRHLIKPTTQIPTLNT----------- 302 Sodalis glo...
O86544           247 IAAHEMAHSIGLLADEYqYEGYGDYPYP----EPAHPNASTltadEMARqrtKWASWLGETDP----------------- 305 Streptomyce...
Q5ZUX5           339 ILIHELGH-FFGLNEEYeGGGRTELEFAPEMKEPWSQNITFl--tTPSYsglKWNELVNPQMSIPTPYSDWq-------- 407 Legionella ...
Q08RZ3           298 IFVHEFGHHFAGLADEY-YTSDSAYLPSEDRAEPWEKNVTAl--kDPSQl--KWKALLSPSTPLPTPWDKDayeaharqi 372 Stigmatella...
4DF9_D           357 ------------------------------------AKYPIGVYEGGG----YSAKGIYRPAFDCRXRTNEYPTFCPVCQ 396 Bacteroides...
Q2IH26           390 qerrkriraqnrpeaemdalflaqqkeetallgearFSKAVGAFEGAN----YEATGYFRPQMDCVMFTRDPVPFCSVCQ 465 Anaeromyxob...
WP_012099097     370 qerrkairarngpewemdalflaqqkeetallsaapHAAHVGAFEGAN----YEASGYYRPQLDCVMFTRDPVPFCAVCR 445 Anaeromyxob...
jgi:Acid345_3935 424 qaerrklradrrpetemeelfrrerekeealfrddqYPSKVGAFEGAN----YEAKGYYRPEENCIMFTRH-TKFCRVCS 498 Candidatus ...
Q025W7           373 qerrrtiraqhrpeaemealfreesglatkllgsgpNAGKVGAFEGAM----YEGRGYFRAQQDCMMFGRD-AGFCAVCR 447 Candidatus ...
Q2NQ58           303 ------------------------------------ENGIIGLFEGAA----YCKKGKYRPVFSSKMKNLGAS-WHAVNE 341 Sodalis glo...
O86544           306 ------------------------------------SGGVVGTFEGAD----YYEYGVYRPTENSIMRSLNTDRFNLPGR 345 Streptomyce...
Q5ZUX5           408 -----------------------------------sTPPQYGAYRGGYgdspSHQGASHKPGLNCIMES--HASFCDICQ 450 Legionella ...
Q08RZ3           373 qqrrkkirseqrpesemdalftaqrdweekflgaqkQASKVGAFEGAM----YEARGYYRPQVDCVMFTRDRVPFCAVCR 448 Stigmatella...
4DF9_D           397 RAIQRII 403 Bacteroides fragilis NCTC 9343
Q2IH26           466 RSIGRVI 472 Anaeromyxobacter dehalogenans 2CP-C
WP_012099097     446 RALSRVI 452 Anaeromyxobacter sp. Fw109-5
jgi:Acid345_3935 499 RAIERII 505 Candidatus Koribacter versatilis Ellin345
Q025W7           448 RAIERVI 454 Candidatus Solibacter usitatus Ellin6076
Q2NQ58           342 EHIKKIM 348 Sodalis glossinidius str. 'morsitans'
O86544           346 EAMIAGF 352 Streptomyces coelicolor
Q5ZUX5           451 KGIMDVI 457 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Q08RZ3           449 HALTEII 455 Stigmatella aurantiaca DW4/3-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap