Conserved Protein Domain Family
LBR_tudor

?
pfam09465: LBR_tudor 
Lamin-B receptor of TUDOR domain
The Lamin-B receptor, found on the TUDOR domain pfam00567, is a chromatin and lamin binding protein in the inner nuclear membrane. It is one of the integral inner Nuclear Envelope membrane proteins responsible for targeting nuclear membranes to chromatin, being a downstream effector of Ran, a small Ras-like nuclear GTPase which regulates NE assembly. Lamin-B receptor interacts with Importin beta, a Ran-binding protein, thereby directly contributing to the fusion of membrane vesicles and the formation of the NE.
Statistics
?
PSSM-Id: 401425
View PSSM: pfam09465
Aligned: 8 rows
Threshold Bit Score: 95.2306
Threshold Setting Gi: 390333249
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001120539   1 MPA-QKYENGETVMARWPGSSLYYEVQVVEFNTQKQEYKVLYKDGTDLDLQEGELK 55  tropical clawed frog
Q5RJ97         1 MPP-ARFQIGDTVMGRWPGSNLYYEVKVMSFDNKTRLYTVIYKDGTELELKESDIT 55  zebrafish
XP_006002534   1 MPN-KKFNIGEVVMGRWPGSSLYYEVKILSYEEKDQLYIVKYKDGTELELKENDIK 55  coelacanth
P23913         1 MPN-RKYADGEVVMGRWPGSVLYYEVQVTSYDDASHLYTVKYKDGTELALKESDIR 55  chicken
XP_003723672   1 MPStTSFGDGDAVMSRWPGSTLWFKSKILRVSEDG--YKVQFEDGTEEEIPLTDVK 54  purple sea urchin
XP_015199756   1 MPS-SKFQSGEMVMGRWPGSSLYYEVKVMNFDAPTELYTVKYKDGTELELKESDIR 55  spotted gar
CAF87329       3 MPS-VKYQKGELVMGRWPGSNLYYQVKVLSFDVKEQLYTVIYKDGTELELKEQDIK 57  spotted green pufferfish
XP_008396802  43 MPS-LKYQAGDKVMGRWPGSSLYYEVKVLGYDAKSRLYTVIYKDGTELELKEQDIm 97  guppy
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap