Conserved Protein Domain Family
Mus7

?
pfam09462: Mus7 
Mus7/MMS22 family
This family includes a conserved region from the Mus7 protein. Mus7 is involved in the repair of replication-associated DNA damage in the fission yeast Schizosaccharomyces pombe. Mus7 functions in the same pathway as Mus81, a subunit of the Mus81-Eme1 structure-specific endonuclease, which has been implicated in the repair of the replication-associated DNA damage. The MMS22 proteins are involved in repairing double-stranded DNA breaks created by the cleavage reaction of topoisomerase II.
Statistics
?
PSSM-Id: 370511
View PSSM: pfam09462
Aligned: 14 rows
Threshold Bit Score: 303.297
Threshold Setting Gi: 74610952
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5AZL9                    1328 LESGWQQVLTTLP------LQEIDVHGISRIGSRF-QGGHDNWTVVKRLLRPVLESDEADLESRpiSYYSYCRV-----L 1395 ...
Q4X0M8                    1301 FENGWLSLFISLP------LNEFDSCGLVRIGARF-QEAHDNWLMVKRLLSPVLDNYDTNAETQpiSCNNYCRA-----L 1368 ...
XP_001275569              1313 YEIGWQKMFTTLP------LNEVDTDGLLKTGVRF-SEGHGNWSMVKRLLSPMLDDYETNSASQpiSYSRYCQA-----L 1380 ...
Q2GP40                    1030 FERIWQDMFTLLP------LSEIDNSGLLVSGARH-VTPVEGWALPQQLLKRVFQLYQANPRQPp-GFNDYCRA-----L 1096 ...
EAA34213                  1265 FERLWQDVFTLLP------LGEIDQMGILLPGLRN-TVPLEGWTLPQKLMKRVFELYTSNQRQSp-SFNEYCRA-----L 1331 ...
Q6BUD9                     881 DEIWWPSINKALNrlislrLPSLGMFDMLYYMASLiPTSKSNWSSFYIIYNAHKSDDNSN------IHNRFIEI------ 948  ...
WGS:AACQ:CAALFM_CR00390WA  920 SGVWWTTIIKALQvy---eAFDLSLLLESVFCLCVfARKGFSWEPLQLVYQKAILEETLGVE----FYYRYLEI------ 986  ...
Q6FXX2                     711 IELIWERLGKNTY------SPSLFSIIITTLPIL-----EPQWQSVK-------------------IINSYENLkgvlkL 760  ...
Q752S7                     580 LPALWQRLASQSF------DPHVAEILVEYFPSR-----TATWSIVK-------------------ADNTFASAekwfmF 629  ...
Q6CSS2                     734 EEMLWQKLRRNKF------SPAVAGVIAMTFRTN-----KQCWSMVK-------------------VNQTYQDAvswikF 783  ...
Q5AZL9                    1396 FQRCFILINGWGWRDCKPILDTLYDFFAKRTLYDLKSEESYKSPA-F-LDELDGNPSFQILPGDSCFHILLKILASGLRF 1473 ...
Q4X0M8                    1369 FRRCYHLINGWGWRDCRPIMQLLYDFFAKRHLYDLKLEESFKSPS-F-LDELDRNPSFDVQPGDPSFHIFLKILATGLRF 1446 ...
XP_001275569              1381 FHRCFHLINGWGWRDCRPIMQFLYDFFAKNQLYDLRFEESYRSPS-F-LDELDRNPSLEVRPGDPTFHIFLKILATGLRF 1458 ...
Q2GP40                    1097 VARCHFLLQQWGWRKCTGVIGTIFDFFGSQNLAHLRNEEVYKSPQ-F-LEELDRKPSLAIEPEDRCFHIFIKLLALAIQR 1174 ...
EAA34213                  1332 IGRCYFLVEQWGWRRCTGIIGTIFDFFGSQNLCHLRNEQVYKSPR-F-LEELADNPSLAIEPEDRCFHIFIKLLALAIQH 1409 ...
Q6BUD9                     949 ---IYSLNERLSWPFEEKLITAIYSAITARKFSNFDDE--KNEPE-L-IDILITRDSIPNTS---FFEKFMHLLYCYVSS 1018 ...
WGS:AACQ:CAALFM_CR00390WA  987 ---VYFMNQRNNWPLPETVVLQIYSSITRMKFANFIDE--IGMPD-L-IGKVSNRFDIPDDS---FFERFMQLLYWYISG 1056 ...
Q6FXX2                     761 VRYC---NSYYKWKPNDLLILQLNKIFKERRFEDFPEEHMESE-----LNHVISSPTEKIKRKT-IFNKYLSIL------ 825  ...
Q752S7                     630 INRC--MASPRDWVVDETLLLQLYDYFKTRKFMDFEEESQEKEYPiVcIRALEERKT--------LFNAFLQML------ 693  ...
Q6CSS2                     784 IGIC--SNEPYEWEITNDLALDLYAFFKARKFEDFEEESRYQNFP--------VVPHLEDELRETLFNTFINIL------ 847  ...
Q5AZL9                    1474 LTkaYDKKTIRNYTWRLLPNHGRDYPKEQPIHQADLNALRNHHDLLCVLYSSVPDGCRPRLGTIKDL-VHPATSHRET-- 1550 ...
Q4X0M8                    1447 LPlfCDKKQIRNFAWRLLPNHDGRYPKEKPISQSDLDAVRNHHDLLCTLFFAVPDGCRPRLEIIKTL-VDPAISHRET-- 1523 ...
XP_001275569              1459 LPlsYDKKQIRNFAWRLLPNHDGRYPKEKPISQADLDAVRNHHDLLCTLYFAVPDGCRPRLETIKNL-VDPAISHRET-- 1535 ...
Q2GP40                    1175 LKelGRPNDIKNLVTRTLPNHSRQYRKEDTIRQHDLAALRNHHDLLCTLFWVSPPELRREVHDIEAL-VVPGTAHKEA-- 1251 ...
EAA34213                  1410 LRqlGRTKDIRNLVTRTLPNHDRQYLKEDTIHERDLAALRNHHDLLCTLFWAAPPDLRPRVDLIERL-ITPSNAHKEA-- 1486 ...
Q6BUD9                    1019 L---PYGGNKKRLISKLFTSSHYHYQKGS----KSFAMFVNRFNFILLLSQLSDVDLRNQVLDL----VQQIKSSNDI-- 1085 ...
WGS:AACQ:CAALFM_CR00390WA 1057 L---SEPSKVKKLVTKLFTFSKFQYVNDQ----SHHVMFINRLNFILLLASVCKVDLKTQLLNL----LEGIENAKDA-- 1123 ...
Q6FXX2                     826 ----RSSNVHSSIIEKITPMSEILTTDTTSI-------LINRVNLIIILSWFSNLNIEKRLSELLKPvLNDSYLHDRDsg 894  ...
Q752S7                     694 ----HSADLSPVTIERMTPLGNLKTLSSAAL-------LANRLNLLMVLASKAKRSYEKRFEELLGPfFEHRSSHLSP-- 760  ...
Q6CSS2                     848 ----ESCRFSTSTLEKLTPMSKIHDLNSPSL-------FVNRLNLLLTLAYQSTYSYERHFEELLEQyVLNLDLDVHQ-- 914  ...
Q5AZL9                    1551 ---CKISLRTWTRLARFKLSTKEDISGLEPFAEWHGYFVTEFLKQHNLARKEIE-----AQIDGGNNFSQQLIDRTVAQN 1622 ...
Q4X0M8                    1524 ---CNISIRAWSRLVRFKLSTDEDLSGLEPFADWLCYFLGEFLRQHSIARKEIE-----AQNIIER-FSQEEVEKTISQN 1594 ...
XP_001275569              1536 ---CNISFRSWIRLVRFKLSTNEDVTDLEAFADWHCYFLNEFLKQHALARKEIE-----AQNAIEKSFSHQQVEKTISQN 1607 ...
Q2GP40                    1252 ---CLINVRAWNQLARFVIAKDEGGGVFRPLAVWRNNVFNQVLDQYLSAASDIEqqfraLSTE-MPSISKDMRDEMVAKN 1327 ...
EAA34213                  1487 ---CLINIRAWNQLARLVVSNGEGSASFRPFITWRNNVFNQILDQYMSAESDIEqqfraLSAENMRSIDAAWREELITKN 1563 ...
Q6BUD9                    1086 ---RMYNITNDGLETYSNIATSKGNSIP---VDSYQIMVETMIDLYVLLPGVQR---------IWKQLLVNLDRYFVPNI 1150 ...
WGS:AACQ:CAALFM_CR00390WA 1124 ---KLIKLASQGVCVLTEIAIQRDTKLP---IEGISIVIQCCINGYYNVHGILK---------VWKNFLISLKDLFRDPL 1188 ...
Q6FXX2                     895 ttrIVARSVLESFLALIRTTAKKNGKISLKL-----NIFHLFFKEYVSKHD--------YLVSMWISFINRTAKISANLP 961  ...
Q752S7                     761 ---SFLSIMLNGQYAMVRISLQKKVELKGKSVLLLWNLIKDQTSNRTLL--------------EWEIFLNNLNNLSVEQH 823  ...
Q6CSS2                     915 ---VIIKAMLEGSLSFFSISHEKKHTVKGKWVPMLWKKVSIYKLN--------------SINKVWRSFWKNLKDILPHLS 977  ...
Q5AZL9                    1623 QRQIESLLKTALQGLQSAI-KSAPSLEHAQKIVSQTPIKLILDLFDSRTTRLNat-vLEGLQVIVMYLqkcgsltgSSTT 1700 ...
Q4X0M8                    1595 QRQIESLLTIALGGLQSAV-RASPTLEHARVVLCKAPIRAILGLFNPRVARLNtv-vSEALQVIIAYLqkc---neNPVA 1669 ...
XP_001275569              1608 QRQIEALLNMALNGLQIAL-RAAPTLEHARILVSKTPIRAILSLFNPRLTRINat-vAEALHVIIAYVkkc---ylDTTP 1682 ...
Q2GP40                    1328 KATALDVLHFSVKASLDVL-QRAPTLEAVSYGLST---------------GFDwgilRVALDTLEHLMg------rIDQA 1385 ...
EAA34213                  1564 KATALDILHTSARASLDVL-KQAKTLEAAIYTLNVTQLQKMCTTLHFGSPGFDwgilNVALDTHAHFLg------wIETS 1636 ...
Q6BUD9                    1151 NSTFAFNNHFMFFALVRRL-EFSKFTDEISVSLVKLLLKAITNIIKAEQFNIS----EKNFELIYIVQ------------ 1213 ...
WGS:AACQ:CAALFM_CR00390WA 1189 SRLSHSL---QLLNISKSI-DINNVPDKIIIDIC-----HVLSHITSSMINVKdmviQKHIKTIKSFN------------ 1247 ...
Q6FXX2                     962 TRTLKSVLKYLVICFEDMQgDIETPLLSANLSLMKFMVKHLE---------------NIHMSIINSRL------------ 1014 ...
Q752S7                     824 ELPID-----MLKNMAPIM---------HNMLTTGSQFKLLHRLVRLYIKSLS----CLSPEWIQNHL------------ 873  ...
Q6CSS2                     978 KSRVA-----ILRSFQSIL---------HNMLLSDKKLNQATQLLDIYVESLE----ILNTDWIQTHV------------ 1027 ...
Q5AZL9                    1701 NSANtLISADEDSQDYGDWTDIEAVYGYESPpiTSGVEHVEQVFHPAVS--RLVSNCFGDDRCPDDAVLLGVVDCWSSMA 1778 ...
Q4X0M8                    1670 AAKTtAVPVDEDSQEYGDWTDIEAIYGGESPpvSRGVEHVESIFLPAVS--RLVSNCFGEDYCPEDATLLKVVDCWTSIA 1747 ...
XP_001275569              1683 PSNApALTTDEDSQEYGDWTEIEAIYGGENPppSKGVEHVEQVFLPAVS--RLVSNCFGEDHCPEDTILLNVIDCWTSIA 1760 ...
Q2GP40                    1386 SEEQ-YSSEFDDNIDAPFLEDAVLLVNEHLT--KDFFWMTRTILALPLE--KSPRRHTQQTACAEKAVTLAA-----RIA 1455 ...
EAA34213                  1637 SEEQySSNESSADIDPRQLEDAILLLQEKLT--KEFFWMARELLALPLKaiTTFGKQTEQVACTEKTVTLAA-----KLA 1709 ...
Q6BUD9                    1214 -------------------------------------EKCFSFLHTQMGr-FPFQNQLTEDRATEI--IEETIKVWIRCN 1253 ...
WGS:AACQ:CAALFM_CR00390WA 1248 -------------------------------------EFVLSLLHRQMGr-LPLPSVIQENRVCDL--IEILLSIWVQCA 1287 ...
Q6FXX2                    1015 ---------------------------------------LSLSKQLAKT-------------------CRPWIKYYTIIC 1036 ...
Q752S7                     874 ---------------------------------------FRLLATPARK-------------------DETLLDSYCLVI 895  ...
Q6CSS2                    1028 ---------------------------------------LQLLVSKAKE-------------------NVTYLHYYCKIA 1049 ...
Q5AZL9                    1779 HTLVKHKLR-RWDS--YLS------------------PYEADSWLALRWTTQTRKFTPQFLAKCIEKDSEILSECKAQIL 1837 ...
Q4X0M8                    1748 SVLVKHGLK-HWDN--YLG------------------HYDGESWSSLRSTVQTRKFTPLFLASCIEKDPECLSECRHLIL 1806 ...
XP_001275569              1761 HVLVKQGLK-HWDN--YLS------------------PYDGDSWLALRSTVQTRKFTPLFLASCIERDPRFLSDCRNQIL 1819 ...
Q2GP40                    1456 ARFVKNRVTvRSSSsfPLAfkhvadldsncyltflpeKYSLFPDVPKNLTTPERRFLPLFLTVLVKNHVFDFRDIGINVL 1535 ...
EAA34213                  1710 ARFIQERVTqVLPYf-QPG------------------KYGLFPDMPKNMSGPERRWLPLFIATLVNKNVFDFKDIETNIL 1770 ...
Q6BUD9                    1254 SILKDVN----WNV------------------------LVLQKYPYIGNAYLRERFVLFFYNELLSFTGLS--NHVDSII 1303 ...
WGS:AACQ:CAALFM_CR00390WA 1288 FVLDES-----WDR------------------------LILQTYAYTGNQQSREQFALYFYSKILQFNNLK--GCKELVT 1336 ...
Q6FXX2                    1037 DYMIQRSEMtFWTYf-QYS------------------GINFDKPNGLYFLRKALSIA----------DDASYQIIRERLY 1087 ...
Q752S7                     896 KHLAEHNVItWWSVi-NYN------------------MFEAEDSIMLLYYTKICKYS----------DAIFFEEAKKFLY 946  ...
Q6CSS2                    1050 KYLTCKNALtWWSLf-HYN------------------TFEDNESISVTYYTFLAEEC----------DASTFSQMKLTVY 1100 ...
Q5AZL9                    1838 GMWLSSLVERVSMLKFQHRFTEAILNWNTEDPVLRNLPFSQNPKeerYSITLSDLSQRRLSLISCVLSNMRvhvqn---- 1913 ...
Q4X0M8                    1807 SMWLSSLVERVSMLKFQHRLTEALLNLDTMNPLLHNLPFSKDRQndrYSISLDDLGQRRLSLLSSLLSNMRahvqg---- 1882 ...
XP_001275569              1820 GLWMSSLVERGSMLKFQHRLTEALLNQDTTNPMLHNLPFLKDRQseqYIISMEDLTQRRLSLLSSLLSNMRahvqa---- 1895 ...
Q2GP40                    1536 GLWMLAVVKPLRYLGYENYLAEVLKH--------HDLAFLERAT---VTVGIPPDYNSNIDFFSCAIQHMRkklr----- 1599 ...
EAA34213                  1771 SLWVQSIIKPMRFLGYETYLAEVLQQ--------RGLPFLAEAD---VSAGMTPDYNIHLDLFSRAIHYMRkalrggatt 1839 ...
Q6BUD9                    1304 LALLKSLALFSTS-----SYLSLIINLLMKS---HYRLFIFKKEyvpEQLTSFQMLNFKLLIASNIIFNIA--------- 1366 ...
WGS:AACQ:CAALFM_CR00390WA 1337 RQVLRDLVCFNPS-----KYLCSILQKLQKE---KWGTFNFGKT---NGITLSMITNSRYVVVTNILQNLA--------- 1396 ...
Q6FXX2                    1088 STLIDKLYIDESD-----DYYALYNTVLGRDLGIK------------LEFKKISGESHQLELVKRLVRTLA--------- 1141 ...
Q752S7                     947 GKSLDFLLKGTSV-----KLQYLLISLSQRDPIFQ----------------IDFGGQVELSQLQTVKKVIR--------- 996  ...
Q6CSS2                    1101 QKILARLIKQTDP-----SLINLINVMASRDSKLQ------------IKIRQTTM-NENVNIMKQFLLALY--------- 1153 ...
Q5AZL9                    1914 -----------lddvkSRDLSTTRQDYREVIQKMMSSMKSNYQELGN--------GEaEVKGAYVEFVQRIVGFL 1969 Asper...
Q4X0M8                    1883 -----------ledteSRELSSTRRDYRELIQRMMASMKANYQELGS--------GGaSAQGAYVDFVHRIVGFL 1938 Asper...
XP_001275569              1896 -----------ledaeSRQLTSPKQDYKELIRRMMVSMKSNYQELGH--------GGgTAQGAYVDFVHRIVGFL 1951 Asper...
Q2GP40                    1600 -------------ehdSVQAKQHRDEFKKTLQVVMQKIKDDLALLR---------SYpSEHGLYIDFVRQVISLI 1652 Chaet...
EAA34213                  1840 papgvtssastagsssAQSIRRQREEFSHTLQLAMTNIKKDLFLLRSlaladptaSStEEHRDYMAFTHGLISLI 1914 Neuro...
Q6BUD9                    1367 -----------------EDERLSKATKIIYLEELIKSLNEEYNKHYL--------SS-----SYVDYCKKLVETV 1411 Debar...
WGS:AACQ:CAALFM_CR00390WA 1397 ----------------SDSSIISMYEYQLYVKDILRTLDIEFEKYYS--------SL-----RYKTFCVNVIKDI 1442 Candi...
Q6FXX2                    1142 -----------------------KLQMYPKINILVQHIISVFNKKFI--------SE--------NFAVNFVQFI 1177 [Cand...
Q752S7                     997 --------------------AFGKASYADLIVEFTRKIRDAYLSFPC--------KR--------DFYYHTLNFL 1035 Eremo...
Q6CSS2                    1154 -----------------------SAGYTTLFHAFLNDLKDVYFQDSA--------EY--------EFIKDIVLFL 1189 Kluyv...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap