5Y9H,5Y9H


Conserved Protein Domain Family
Saf-Nte_pilin

?
pfam09460: Saf-Nte_pilin 
Click on image for an interactive view with Cn3D
Saf-pilin pilus formation protein
This domain consists of the adjacent Saf-Nte and Saf-pilin chains of the pilus-forming complex. Pilus assembly in Gram-negative bacteria involves a Donor-strand exchange mechanism between the C- and the N-termini of this domain. The C-terminal subunit forms an incomplete Ig-fold which is then complemented by the 10-18 residue N-terminus of another, incoming, pilus subunit which is not involved in the Ig-fold. The N-terminus sequences contain a motif of alternating hydrophobic residues that occupy the P2 to P5 binding pockets in the groove of the first pilus subunit.
Statistics
?
PSSM-Id: 370509
View PSSM: pfam09460
Aligned: 2 rows
Threshold Bit Score: 301.34
Threshold Setting Gi: 1279526781
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y9H_A 152 GSFLPNSEQQKSVDIVFSSPQDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKN 231 Salmonella enterica s...
5Y9H_A 152 GSFLPNSEQQKSVDIVFSSPQDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKN 231 Salmonella enterica s...
5Y9H_A 232 TGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP 295 Salmonella enterica subsp. enterica s...
5Y9H_A 232 TGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP 295 Salmonella enterica subsp. enterica s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap