2J5H


Conserved Protein Domain Family
CFC

?
pfam09443: CFC 
Cripto_Frl-1_Cryptic (CFC)
CFC domain is one half of the membrane protein Cripto, a protein overexpressed in many tumors and structurally similar to the C-terminal extracellular portions of Jagged 1 and Jagged 2. CFC is approx 40-residues long, compacted by three internal disulphide bridges, and binds Alk4 via a hydrophobic patch. CFC is structurally homologous to the VWFC-like domain.
Statistics
?
PSSM-Id: 401411
View PSSM: pfam09443
Aligned: 26 rows
Threshold Bit Score: 48.017
Threshold Setting Gi: 1774940707
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2J5H_A         5 CGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGC 39 
XP_006001956 156 CGGISHGEWVSNGCSWCRCGYGVFHCFQHASQEDC 190 coelacanth
NP_001315337 116 CGVIPHGEWVQKGCSYCRCGYGLLHCFPHVFSKDC 150 zebrafish
NP_001078829  77 CGIIAHGHWIQKKCALCRCMYGTMHCFA---SGDC 108 tropical clawed frog
EKC29226      61 CRHVPHGYWIRSDCDKCRCFNGRIFCIPKYYF-GC 94  Pacific oyster
XP_016846471 125 CGPFKHGEWMRKGCQLCRCGYGILHCLPEH-ITNC 158 green anole
XP_007498006 123 CGVFAHGDWVYKGCYLCRCIYGKLHCFRDPTLNNC 157 gray short-tailed opossum
XP_015192501 116 CGIIPHGEWIQKGCSYCRCMYGVLHCFPLVFQDGC 150 spotted gar
XP_016160091 154 CGSIPHGLWVLKGCWLCRCGYGTLHCLSEVMRRNC 188 collared flycatcher
EOB00982     118 CGSIAHGAWVLKGCWLCRCGFGTLNCLSEIMHENC 152 mallard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap