4NPX,4U12


Conserved Protein Domain Family
DUF2018

?
pfam09442: DUF2018 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF2018)
Acid-adaptive protein possibly of physiological significance when H.pylori colonises the human stomach, which adopts a unique four alpha-helical triangular conformations. The biologically active form is thought to be a tetramer. The protein is expressed along with six other proteins, some of which are related to iron storage and haem biosynthesis.
Statistics
?
PSSM-Id: 401410
View PSSM: pfam09442
Aligned: 19 rows
Threshold Bit Score: 68.4455
Threshold Setting Gi: 667485233
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4NPX_A             36 FNKTPKEKFIEIIQNGNLGALEKVFEEFFADHIAXVELLEKQ-GLT---EXDVKNFILE--NGDFIEERQNDIYIELGAK 109 Campylobac...
tigr:CHAB381_0894  17 FEGNPKDKFFDIIFHASKTLVENEIENLLMRAVALENLCEKA-GID---ETEIFNFIVE--NPDIMENALNDKYIELTGN 90  Campylobac...
jgi:Sdel_1329      11 I-GTPQSKFFDILFHANREIVKNKLLQCIDRYNAMELLLEQHlGEEv-lEKEIQSTLLE--KSDTVLERNQDLFIALMGE 86  Sulfurospi...
USDA:Abu_0385      16 FMGSPKSKFFDVVNEASKDIVEEEIDKIIEKLAVLEMMMSEDkGEEfniNNHIKEYILE--NEDKVKAMKKGLYVEFTGE 93  Arcobacter...
WP_013134454        5 lfGTPKSKFLDVLRHASSEIVDDEIDKILEKYAAMELLLSKDkGENydvNEDINSFVLE--NLDEVSKVKDDLYIEFTGE 82  Arcobacter...
jgi:Saut_0902      14 FGGSPRSKFMDVVFNANNDIVRQELENFIEKAATMELMLEEQlGEDv--DDAIARYKNS--HLDDVNTKTKSIFVEIMGS 89  Sulfurimon...
WP_011980332       10 MASSPRESYFSIAKTANQNITEMEIEKMFRRLAVAEKMLEEK-GLDeelERQIKALVIN----EDVDRRLDSIFIEMMGN 84  Sulfurovum...
WP_013553852       12 lSTTPRENFFQVIHTANRNIVDLELEKLIERLAVAEKMLEEK-GLEeeyERQVLTLPTA--EPTEIENRKNSLFIETVGN 88  Nitratifra...
Q7MR83              8 FEGTPEERWLEILFHANRTLAQNELLFLLERLSLLEHSLDS---LDpswEERLKAq----eNLSEVKKKMGSLAIESMGR 80  Wolinella ...
WP_012082399        9 LGGSPKSRFLDIVFHANRNVVEKELEEIMEWMAALELIVEQKcGMDv--EKEVRNILFDdsKKKDLENKVNSLYIEYMGK 86  Nitratirup...
4NPX_A            110 ILG-HE 114 Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
tigr:CHAB381_0894  91 ILSnNE 96  Campylobacter hominis ATCC BAA-381
jgi:Sdel_1329      87 ILSqNE 92  Sulfurospirillum deleyianum DSM 6946
USDA:Abu_0385      94 IICr-L 98  Arcobacter butzleri RM4018
WP_013134454       83 IICr-L 87  Arcobacter nitrofigilis
jgi:Saut_0902      90 ILSqSE 95  Sulfurimonas autotrophica DSM 16294
WP_011980332       85 IVTqCE 90  Sulfurovum sp. NBC37-1
WP_013553852       89 IVTqCE 94  Nitratifractor salsuginis
Q7MR83             81 ILSqNE 86  Wolinella succinogenes
WP_012082399       87 ILSqSE 92  Nitratiruptor sp. SB155-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap