Conserved Protein Domain Family
Abp2

?
pfam09441: Abp2 
ARS binding protein 2
This DNA-binding protein binds to the autonomously replicating sequence (ARS) binding element. It may play a role in regulating the cell cycle response to stress signals.
Statistics
?
PSSM-Id: 401409
View PSSM: pfam09441
Aligned: 33 rows
Threshold Bit Score: 259.481
Threshold Setting Gi: 15213924
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_014174878          5 LPDRS-VTGTTIEDAYVSFILYCNPIVPLDSSTAALREAFRTPPRSGGKSFSIYTLFLLICQLESKQIKTWAELALKLGV 83  Grosmann...
WGS:ACPH:TERG_04158 137 LPSRD-ITNATIDDAYVEFILYCNPTIPSSTNTSELRRMFRSPPRSEGKNFCTFMLWELIQKLNRKELKTWIQLAIELGV 215 Trichoph...
EFW22913             87 LPSRN-ITDATIDDAYVDFIFYCNPGVPSTTNTSELRRMFRLPPRSDGKCFSIYTLWELIQKLDRKEIKTWIQLAIELGV 165 Coccidio...
XP_007704063        147 PPPRD-VSDDTIDNAYAAFILYCNPNFPTTTDTTELVKLFRTPPKSDGNAFSTWVLFELIRKFDAKEIKTWTQLALDLGV 225 Bipolari...
EON61757            112 LPPRD-VSDDTLDAAYAAFILYCNASFPLSIDTSELIKAFRNPPKSDGKNYSTWTLFNLIQEFDRKEIKTWAELAQRLGV 190 Coniospo...
EKG11294             86 LPSTEsVSAENIDEIYAAFVLYCNPYFPPQYDTTELKKVFKKPPMSDNKTFDPYNLFELLKKLEKGEIKTWIQLALDLGV 165 Macropho...
EMC96156              4 LPSTD-VTAETLTDAYVAFIFYCNPQFALDTDTDVLRATFNSPPKSDSKEFQTYVLFRLIQKLDAKDIKTWGQVALDLGV 82  Baudoini...
XP_003854861         17 LPSRD-VTADTITDAFVDFILYCNPHFPLDVDTSTLRTNFESPPKSDGKDFETFRLFELIKKFDAKELKTWGQLALDLGV 95  Zymosept...
EPE36265             64 LPSRD-VTDNNFDDAYVSFILHCNPSIPPETDTVELKKTFRAPPKSDGKSFSTYTLFELIGKLERKELKTWAQLAIELGV 142 Glarea l...
EDN97061             74 LPSRE-VTDENFDDAYVGFIMYCNPTVAADTDTAELRRIFRAPPKSDNKSFSTFILFELIRKLENKEIKTWAQLAIDLGV 152 Scleroti...
XP_014174878         84 DPPDQDSGQSSQKIQQYAVRLKltrsqRWMHAMHVDAFFDYLMDRGHSYWTEVPSDLGAFDDYLRDGVAAKDDMALRALV 163 Grosmann...
WGS:ACPH:TERG_04158 216 EPPSVEKKQSTQKVQQYAVRLK-----RWMRAMHIDAFFEYCLGHQHPYYTKVH-PLTEQEEECRDGVPRDEDLALRALV 289 Trichoph...
EFW22913            166 EPPSVEKKQSTQKVQQYAVRLK-----RWMRAMHVDAFFDYCMGNQHPYYTNVG-ALHDQDGGYRDGVSREEDLTLRALY 239 Coccidio...
XP_007704063        226 KPPNTDEGQSTQKVQQYSVRLK-----RWMRAMHIDAFFEYLLGKQHPYYLQIPPSHQPFPSQGRDGVPLEEDLAIRALD 300 Bipolari...
EON61757            191 LPPDLEKGQSTQKVQQYSVRLK-----RWMRALHIDAFFEYLMNKPHAYYEEVPPLHAPFPEDGRDGVPLEEDLAVRALD 265 Coniospo...
EKG11294            166 EPPDVEKGQSTQKVQQYAVRLK-----RWMRAMHIDAFFDFLQGKSHSYYTNIPPPNDPFPPGGRDGVPLEEDLAIRGLD 240 Macropho...
EMC96156             83 EAPDINKGQSVQKVQQYTVRLK-----RWMRAMHIDAFFEYLLGKQHAYFNEIPPTSTPYPPGGRDGVAPEEDLAIRALD 157 Baudoini...
XP_003854861         96 EAPDVSKGQSVQKVQQYSVRLK-----RWMRAMHIDAFFEFLLGKQHSYATEIPPPNDPYPTTGRDGVMAEEDLAIRALD 170 Zymosept...
EPE36265            143 EQPDPQKGQSAQKVQQYAVRLK-----RWMHAMHVDAFFEYLLNKPHIYWTDVP-GVNEAALDGRDGVPTEEDLALRALL 216 Glarea l...
EDN97061            153 EPPALEKGQSAQKVQQYAVRLK-----RWLHAMHVDAFFEYLLNKPHVYWTQVPPPNEPPSELGRDGVTADEDLALRALL 227 Scleroti...
XP_014174878        164 PEIKPRRGRRRPDEDAD 180 Grosmannia clavigera kw1407
WGS:ACPH:TERG_04158 290 PEWKPKRGRKRVDD--I 304 Trichophyton rubrum CBS 118892
EFW22913            240 PEWKPRKGRKRA----L 252 Coccidioides posadasii str. Silveira
XP_007704063        301 PKFKPKRGRRKADDGED 317 Bipolaris sorokiniana ND90Pr
EON61757            266 PKYRPKRGRRKADEEDG 282 Coniosporium apollinis CBS 100218
EKG11294            241 PAFKPKRGRKKAEDLED 257 Macrophomina phaseolina MS6
EMC96156            158 PTFRPKRGRRRNSEIEL 174 Baudoinia panamericana UAMH 10762
XP_003854861        171 PAFRPKRGRRRNSETEQ 187 Zymoseptoria tritici IPO323
EPE36265            217 PETKPKRGRRKAEDRDI 233 Glarea lozoyensis ATCC 20868
EDN97061            228 PETRPKRGRKKAEDRED 244 Sclerotinia sclerotiorum 1980 UF-70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap