Conserved Protein Domain Family
DUF2015

?
pfam09435: DUF2015 
Fungal protein of unknown function (DUF2015)
This is a fungal family of uncharacterized proteins.
Statistics
?
PSSM-Id: 401406
View PSSM: pfam09435
Aligned: 75 rows
Threshold Bit Score: 129.968
Threshold Setting Gi: 344234707
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007675253   8 LTFIFLI--VATALYVTRHAWkpyappipyvtapgtipeplynisnyisNYIns-----frYVQLpq-sATFAEDAEAGL 79  Baudoinia panam...
XP_001483551  33 IVVILII--AAILVFHFRHRIaaa-----------------------hdRWRtrr---rmgYVNLd---LSFQDDLEGGL 81  Meyerozyma guil...
Q6BIE9        32 MLVFFII--TVIVLFHFRHKLaaa-----------------------hdRYRtrr---rlrFSRIpsdeNGFEDDLENGL 83  Debaryomyces ha...
XP_004202104  12 CFLAVVI--IVLLGFHFRNKIaaa-----------------------hdRFRsrr---rlrYSGIse-pTGFEEDLENGL 62  Pichia farinosa...
EGV66575      37 LLLLTII--ICLLIFHFRNKIaef-----------------------hdRLRtkr---rmrYANLs---QGFQDDLESGL 85  Yamadazyma tenu...
XP_003644356  14 VMVGLL-----FLAHRKREAIkdm-----------------------aySMAaklklkfggYIRIn---DHFVEDMEAGL 62  Eremothecium cy...
Q876Z1        15 VMAGIL-----VVAHRNRETIryk-----------------------tsEFMvrlrsrfggYTSIn---DHFVRDLEDGF 63  Eremothecium go...
Q8J0M4         9 LLLWVVLlsLCLLMAHRKTKVadk-----------------------frALRsriqlrfnrHIRLn---DSFADDLENGL 62  Saccharomyces c...
CCK71587      50 TVLGVG-----YFVYIKRDQLafe-----------------------crEIKtrigklfgrRIALn---DSFAEDVESGF 98  Kazachstania na...
XP_004180501  12 TFILIAI--FGYLLYRNKEKIayt-----------------------arETLyrlrrgtvgSISLn---DSFHEDLESGL 63  Tetrapisispora ...
XP_007675253  80 HSSNFNL-AENIEAGDSRRGLDENAKQEVYKIMKIRRVGFDEARRLYIEERFGREGIAADGRPLDRK 145 Baudoinia panamericana UAMH ...
XP_001483551  82 NSESFDI-RSNIDSEDSRKGLLEEGKREIKRIMNERGITFDEARLEYTRSRLAENNIDADGMPLDPK 147 Meyerozyma guilliermondii AT...
Q6BIE9        84 SSSTFDI-GENISNNDQRQGLLQNAKEEVKRIMDNSNLTFDQARYQYTQQQLDENGIGKDGTPLDPK 149 Debaryomyces hansenii
XP_004202104  63 SSNYFDL-HENISNEDSRAGLESNAKTEIKKIMEQNNIDFDEARLIYTRRQMKSNNIGSNGEPLDPR 128 Pichia farinosa CBS 7064
EGV66575      86 NSDAFNIlSGN--SNDHRQGLEENAKAAIYQLMQQKSLTFDEARLEYTKSQFGEHNIDSNGVPLDPK 150 Yamadazyma tenuis ATCC 10573
XP_003644356  63 SSRNFNIlSSN--SQDPRSGLDEVSKEEIRRIMQHEDISFDKARLIYTTKKFSENGIAPDGTPLDPK 127 Eremothecium cymbalariae DBV...
Q876Z1        64 SSQNFDLtSAN--SNDTRSGLDEASKQEIRRIMEEQGLGFDQARLVYTTRKFGAHGIAPDGMPLDPK 128 Eremothecium gossypii ATCC 1...
Q8J0M4        63 HSRNFDIiSEN--SNDVRGGLDDVSKNEIKQIMENDNVDFDKARLLYMERKFGQNGIAPDGTPIDPK 127 Saccharomyces cerevisiae S288C
CCK71587      99 HSQNFDIrSEN--GEDSRSGLDNAAKAEIRRIMNNENLTFDKARLRYTERQFGKNLIAPDGTPLDPK 163 Kazachstania naganishii CBS ...
XP_004180501  64 SSRNFDIiSKN--TDDGRSGLDDESKKEIKKIMEEENLTFDKARLLFTERKFNANGIAADGTPLDPK 128 Tetrapisispora blattae CBS 6284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap