3ETW


Conserved Protein Domain Family
FadA

?
pfam09403: FadA 
Adhesion protein FadA
FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices.
Statistics
?
PSSM-Id: 401379
View PSSM: pfam09403
Aligned: 22 rows
Threshold Bit Score: 58.4495
Threshold Setting Gi: 545659647
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ETW_A                 10 ELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQELASKYEDALKKLEA 89 
Q8RIP2                 25 ELKGLNAEYENLVKEEEARFQKEKELSERAAAQNVKLAELKASIEEKLLAAPEERKTKFFKDTFDGLVKDYSKYLSQINE 104 Fusoba...
WP_021766137           35 SLSNLEAQLQKLEQMEENKFREQEAVANAAQQRLDNYLKMDAAIDQRIADIEANADTSIFGKEFKQKAAEYKKLKEELAK 114 Leptot...
WP_006805726           36 SLNNLENQLSRLQQMEDAKFREQEAQANAAVQRLNNYTAMQAKIDQRIAEIEANAETSIFGKEFKSKIAEYKNLRNQLDK 115 Leptot...
WP_015770159           35 SLSNLENQLDRLQQLEEAKYKEQEALAESAAQKLNSYTQMQAKIDERIAQIEAVTDSSIFSKEFKTKVSEYKALRNQLDK 114 Leptot...
WGS:ACIE:FVAG_00874.1  28 QMKSLEKEYQLLLKKEDQRYAQEKQIAETAEKTLAEQKNLYKSVAGSLSQLQQMEKYIFYKDDYNQLLNKYQTILKDLEK 107 Fusoba...
Q8RGM7                 28 ELQALDAEYQNLANQEEARFNEERAQADAARQALAQNEQVYNELSQRAQRLQAEANTRFYKSQYQDLASKYEDALKKLES 107 Fusoba...
WP_005950432           28 RFNTLEQEYKMLMQKEDERYNSEKQIAETAKATLAKQRELYNQISTKAGKLGQIKDVKFYKEQYGELAKKYQDALKELEG 107 Fusoba...
jgi:Sterm_0628         27 QAAAIDQQIQVIENRTSQTLAAEQQKAEVATDNVAKYSELLENVQDQLDVVAGERKVSFYEKEYQGVISSLTSLRNDLQK 106 Sebald...
jgi:Sterm_0627         38 RYDAISNQLDALRAKDDQRFQLEQQKADNAQAELDKQVEMRDELQAKYEEAAQLAKISYYKNTYGPVANQYKDLLGKLDS 117 Sebald...
3ETW_A                 90 EMEQQKAVISDFEKIQALR 108
Q8RIP2                105 KIAENTEIVSNFEKIQKIR 123 Fusobacterium nucleatum subsp. nucleatum
WP_021766137          115 EIKKEQQILENFELLKSLR 133 Leptotrichia sp. oral taxon 215
WP_006805726          116 EIAREQQAIDNYELIKSLR 134 Leptotrichia hofstadii
WP_015770159          115 EIARQQQIIDNFEISKSLR 133 Leptotrichia buccalis
WGS:ACIE:FVAG_00874.1 108 SMNNQQVIIDNFKQIQLEK 126 Fusobacterium varium ATCC 27725
Q8RGM7                108 EMEQQKAIISDFEKIQALR 126 Fusobacterium nucleatum subsp. nucleatum
WP_005950432          108 QMKEQESIINRFQQLQAVK 126 Fusobacterium
jgi:Sterm_0628        107 SITANQKVVDAYEEFSAIV 125 Sebaldella termitidis ATCC 33386
jgi:Sterm_0627        118 SIKENQKIIDNFEKLSAAR 136 Sebaldella termitidis ATCC 33386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap